DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdp and PPM1D

DIOPT Version :9

Sequence 1:NP_001245567.1 Gene:Pdp / 31683 FlyBaseID:FBgn0029958 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_003611.1 Gene:PPM1D / 8493 HGNCID:9277 Length:605 Species:Homo sapiens


Alignment Length:332 Identity:79/332 - (23%)
Similarity:121/332 - (36%) Gaps:118/332 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 CEDSRTEASFLHRNGFICGIFDGHAGAACGQVVSKRLLRYVS-----AATLPRQVLREQMKQGAD 131
            |...|:..:|.       .:.|||.|....|...:.|..::.     .::.|.:|.      .|.
Human    91 CCRRRSSVAFF-------AVCDGHGGREAAQFAREHLWGFIKKQKGFTSSEPAKVC------AAI 142

  Fly   132 SQSFLKCHNDNVDFVSMIKPMYEASFLKYVNQLLETPQRDVSSELVNAFLQLDEEISQEALTSND 196
            .:.||.||      ::|.|            :|.|.|                            
Human   143 RKGFLACH------LAMWK------------KLAEWP---------------------------- 161

  Fly   197 VRTMN--VALSGAVACLVHIEGLQMHVASTGDCGAVLGVLDP---------QTQQWHSKKLNIEH 250
             :||.  .:.||..|.:|.|.|::|:||..||.|.|||:.|.         :..|.|..:|..|.
Human   162 -KTMTGLPSTSGTTASVVIIRGMKMYVAHVGDSGVVLGIQDDPKDDFVRAVEVTQDHKPELPKER 225

  Fly   251 --------NADNMSEVRRILAEHPKEEHETVIRNGRLLSQ---LAPLRAFGDFRYKWSQEIMQQK 304
                    :..|.|.|.|::.:.|:..|...:|...::.|   ||..||.||.   ||.:...  
Human   226 ERIEGLGGSVMNKSGVNRVVWKRPRLTHNGPVRRSTVIDQIPFLAVARALGDL---WSYDFFS-- 285

  Fly   305 VLPMFGVQAMAPNYYTPPYLTARPDVQQHELGP-NDKFLVIASDGLWDFLPPSEVVS-------- 360
                 |...::|          .||...|.|.| ..|::::.|||||:.:||.:.:|        
Human   286 -----GEFVVSP----------EPDTSVHTLDPQKHKYIILGSDGLWNMIPPQDAISMCQDQEEK 335

  Fly   361 --LVGEH 365
              |:|||
Human   336 KYLMGEH 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdpNP_001245567.1 PP2Cc 58..394 CDD:238083 79/332 (24%)
PPM1DNP_003611.1 Interaction with CHEK1. /evidence=ECO:0000269|PubMed:15870257 1..101 2/9 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 28..90
PP2C 67..368 CDD:278884 79/332 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 516..591
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.