DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdp and AT2G40860

DIOPT Version :9

Sequence 1:NP_001245567.1 Gene:Pdp / 31683 FlyBaseID:FBgn0029958 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_850336.1 Gene:AT2G40860 / 818684 AraportID:AT2G40860 Length:658 Species:Arabidopsis thaliana


Alignment Length:304 Identity:68/304 - (22%)
Similarity:106/304 - (34%) Gaps:124/304 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 IFDGHAGAACGQVVSKRLLRYVSAATLPRQVLREQMKQGADSQSFLKCHNDNVDFVSMIKPMYEA 155
            |||||.|||..:         .||..||                                     
plant   426 IFDGHRGAAAAE---------FSAQVLP------------------------------------- 444

  Fly   156 SFLKYVNQLLETPQRDVSSELVNAFLQLDEEISQEALTSNDVRTMNVALS--------GAVACLV 212
               ..|..|..|...:..|:   ||::.|....||.    |....:..:|        .|:|.|:
plant   445 ---GLVQSLCSTSAGEALSQ---AFVRTDLAFRQEL----DSHRQSKRVSQKDWHPGCTAIASLL 499

  Fly   213 HIEGLQMHVASTGDCGAVLGVLDPQTQQWHSKKLNIEHNADNMSEVRRILAEHPKEEHETVIRNG 277
             :|. ::.||:.||..|:|      .:..|...|:..|.|..:.|..|::.|           .|
plant   500 -VEN-KLFVANVGDSRAIL------CRAGHPFALSKAHLATCIDERNRVIGE-----------GG 545

  Fly   278 RL-----LSQLAP-----LRAFGDFRYKWSQEIMQQKVLPMFGVQAMAPNYYTPPYLTARPDVQQ 332
            |:     ..::||     .|:.||...|                          |.:||.|::.:
plant   546 RIEWLVDTWRVAPAGLQVTRSIGDDDLK--------------------------PAVTAEPEISE 584

  Fly   333 HELGPNDKFLVIASDGLWDFLPPSEVVSLVGEHIN-----SKKI 371
            ..|..:|:|||:|||||||.:...||:.::.:.:.     ||::
plant   585 TILSADDEFLVMASDGLWDVMNDEEVIGIIRDTVKEPSMCSKRL 628

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdpNP_001245567.1 PP2Cc 58..394 CDD:238083 68/304 (22%)
AT2G40860NP_850336.1 S_TKc 30..307 CDD:214567
PKc_like 36..311 CDD:304357
PP2Cc 391..648 CDD:238083 68/304 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.