DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdp and ppm1h

DIOPT Version :9

Sequence 1:NP_001245567.1 Gene:Pdp / 31683 FlyBaseID:FBgn0029958 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_001070923.1 Gene:ppm1h / 768291 ZFINID:ZDB-GENE-061027-190 Length:516 Species:Danio rerio


Alignment Length:394 Identity:74/394 - (18%)
Similarity:133/394 - (33%) Gaps:127/394 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 PVDGVIRSYETNQLGSNWPCED--------SRTEASFLHRNGFICGIFDGHAGAACGQVVSKRLL 109
            |.|....||..::..|:.|..|        ...|..|.:     ..:||||.|:......:|.|.
Zfish   101 PADPSSVSYTPSRRRSSLPSGDVLDTIHNPEVKELDFHY-----WALFDGHGGSGAAVFAAKFLH 160

  Fly   110 RYVSAATLPRQVLREQMKQGADSQSFLKCHNDNVDFVSMI----KPMYEASFLKYVNQLLETP-- 168
            .::....  ::||......|....:.|...:.|....:..    :.:..|:.|:.......:|  
Zfish   161 LHIEEQL--QEVLEILQDPGLQPPTCLGEESPNPQLHASASGSQRGLSRAASLRGAAGAPGSPNT 223

  Fly   169 -------QRDVSSE------LVNAFLQLDEEISQEALTSNDVRTMNVALSGAVACLVHIEGL-QM 219
                   ::.:..|      :.|||.::|..|::|...        .::||....|..:..| ::
Zfish   224 MAPRFFMEKKIKQESLVVGAIENAFKEMDAHIARERCA--------YSISGGCTALAVMFLLGKL 280

  Fly   220 HVASTGDCGAVL---GVLDPQTQQWHSKKLNIEHNADNMSEVRRILAEHPKEEHETVIRNGRLLS 281
            :||:.||..|::   |.|...:..:                       .|:.|.:.:    :.|:
Zfish   281 YVANAGDSRALIVRAGELITMSSSF-----------------------TPESERQRL----QFLA 318

  Fly   282 QLAPLRAFGDFRY------------------------KWSQEIMQQ---------------KVLP 307
            .|.|.....||.:                        .|:.:.:|:               :||.
Zfish   319 HLQPSLLGSDFTHLEFPRRVTKREIGKRMLYRDFTMNGWAYKTVQEEDLKFPLIYGEGKKARVLA 383

  Fly   308 MFGV---------QAMAPNYYTPPYLTARPDVQ-----QHELGPNDKFLVIASDGLWDFLPPSEV 358
            ..|:         :....:....|:|:..|:||     |.|.|.:| .|::|:|||||.|...||
Zfish   384 TIGITRGLGDHDLKVHDSDIAIKPFLSCSPEVQVYNLCQFEHGADD-VLILATDGLWDVLSNQEV 447

  Fly   359 VSLV 362
            ...|
Zfish   448 ADAV 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdpNP_001245567.1 PP2Cc 58..394 CDD:238083 72/389 (19%)
ppm1hNP_001070923.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 102..122 5/19 (26%)
PP2Cc 127..506 CDD:238083 67/368 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 181..202 2/20 (10%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577954
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.