DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdp and ppm1lb

DIOPT Version :9

Sequence 1:NP_001245567.1 Gene:Pdp / 31683 FlyBaseID:FBgn0029958 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_001307112.1 Gene:ppm1lb / 767640 ZFINID:ZDB-GENE-060929-136 Length:348 Species:Danio rerio


Alignment Length:296 Identity:66/296 - (22%)
Similarity:110/296 - (37%) Gaps:97/296 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 ICGIFDGHAGAACGQVVSKRLLRYVSAATLPRQVLREQMKQGADSQSFLKCHNDNVDFVSMIKPM 152
            |..|:|||.|.|..:         .:.|.|| .:||:|:::                        
Zfish   112 IFSIYDGHGGEAAAE---------YAKAHLP-IMLRQQLQR------------------------ 142

  Fly   153 YEASFLKYVNQLLETPQRDVSSELV--NAFLQLDEEISQEALTSNDVRTMNVALSGAVACLVH-I 214
            ||.          :.....||.:.:  ...|.:|.||.::...|.|        .....|||. :
Zfish   143 YER----------QKENSAVSRQAILRQQILNMDREILEKLTASYD--------EAGTTCLVALL 189

  Fly   215 EGLQMHVASTGDCGAVLGVLDPQTQQWHSKKLNIEHNADNMSEVRRILAEHPKEEHETVIRNG-- 277
            ...::.||:.||..|||...|     .::..|:.:|....:.|.:||     |:....:..:|  
Zfish   190 SEKELTVANVGDSRAVLCDKD-----GNAIPLSHDHKPYQLKERKRI-----KKAGGFISFSGSW 244

  Fly   278 RLLSQLAPLRAFGDFRYKWSQEIMQQKVLPMFGVQAMAPNYYTPPYLTARPDVQQHELGP-NDKF 341
            |:...|:..|:.|||              |:..::.:.|:          ||:...:|.. ..:|
Zfish   245 RVQGVLSMSRSLGDF--------------PLKKLKVLIPD----------PDLMTFDLDTLQPQF 285

  Fly   342 LVIASDGLWDFLPPSEVVSLVGE-----HINSKKIL 372
            :::|||||||.....|.|..:.|     |..:|.|:
Zfish   286 MILASDGLWDTFSNEEAVHFIKERLDEPHFGAKSIV 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdpNP_001245567.1 PP2Cc 58..394 CDD:238083 66/296 (22%)
ppm1lbNP_001307112.1 PP2Cc 82..340 CDD:238083 66/296 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.