DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdp and Ppm1m

DIOPT Version :9

Sequence 1:NP_001245567.1 Gene:Pdp / 31683 FlyBaseID:FBgn0029958 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_080723.3 Gene:Ppm1m / 67905 MGIID:1915155 Length:462 Species:Mus musculus


Alignment Length:435 Identity:88/435 - (20%)
Similarity:149/435 - (34%) Gaps:163/435 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 GFICGIFDGHAGAACGQVVSKRLLRYVSAATLPRQVLREQMKQGADSQSFLKCHNDNVDFVSMIK 150
            |....:||||.|.|..          :.||......||.|::...:.            .::...
Mouse   120 GHYWALFDGHGGPAAA----------ILAANTLHSCLRRQLEAVVEG------------MIAPQP 162

  Fly   151 PMY---------EASFLKYVNQLLETPQRDVSSE------LVNAFLQLDEEISQEALTSNDVRTM 200
            ||:         :..|::         ::.:.:|      |.|||.:.|:.|.:|...|..|   
Mouse   163 PMHLSGRCVCPSDPQFVE---------EKGIQAEDLVIGALENAFQECDDVIGRELEASGQV--- 215

  Fly   201 NVALSGAVACL-VHIEGLQMHVASTGDCGAVL----------GVLDPQTQQWHSKKLNIEHNADN 254
                .|..|.: |.::| :::||:.||..|:|          ....|:|::...::|...:....
Mouse   216 ----GGCTALVAVFLQG-KLYVANAGDSRAILVRRHEIRQLSSEFTPETERQRIQQLAFTYPELL 275

  Fly   255 MSEVRRILAEHPK-------------EEHE----------------TVI----RNGRLLSQLAPL 286
            ..|..|:  |.|:             .:|.                .:|    |..|||..||..
Mouse   276 AGEFTRL--EFPRRLKGDDLGQKVLFRDHHMRGWSYKRVEKSDLKYPLIHGQGRQARLLGTLAVS 338

  Fly   287 RAFGDFRYKWSQEIMQQKVLPMFGVQAMAPNYYTPPYLTARPDV---QQHELGPNDK-FLVIASD 347
            |..||.:.:.....:|.|                 |:|.:.|.|   ..|:|...:: .:|:|:|
Mouse   339 RGLGDHQLRVLDTDIQLK-----------------PFLLSIPQVTVLDVHQLAVQEEDVVVMATD 386

  Fly   348 GLWDFLPPSEVVSLVGEHINSKKILEPMRLPEGDTTLQEISQQLAERKAGLTRKPVDQNAATHLI 412
            ||||.|...:|..||...:...:..:|.|..|           ||:                 ::
Mouse   387 GLWDVLSNEQVALLVRSFLTGNQKDDPHRFSE-----------LAK-----------------ML 423

  Fly   413 RHALGGTDYGIE-HSKISYYLTLPRDAVRLYRDDITITVIYFNSE 456
            .|...|.|.|.. ..::||             ||:::.||..:|:
Mouse   424 IHNTQGKDNGATGEGQVSY-------------DDVSVFVIPLHSQ 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdpNP_001245567.1 PP2Cc 58..394 CDD:238083 77/370 (21%)
Ppm1mNP_080723.3 PP2Cc 109..452 CDD:238083 87/430 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834875
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.