DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdp and Ilkap

DIOPT Version :9

Sequence 1:NP_001245567.1 Gene:Pdp / 31683 FlyBaseID:FBgn0029958 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_075832.1 Gene:Ilkap / 67444 MGIID:1914694 Length:392 Species:Mus musculus


Alignment Length:368 Identity:76/368 - (20%)
Similarity:142/368 - (38%) Gaps:97/368 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 IRSYETNQLGSNWPCEDSRT-----------EASFLHRNGFICGIFDGHAGAACGQVVSKRLLRY 111
            ::.|...:.|.....:|:..           .:|.:.|..:. .:||||.|....:..::.|   
Mouse   107 LKGYVAERKGEREEMQDAHVILNDITQECNPPSSLITRVSYF-AVFDGHGGIRASKFAAQNL--- 167

  Fly   112 VSAATLPRQVLREQMKQGADSQSFLKCHNDNVDFVSMIKPMYEASFLKYVNQLLETPQRDVSSEL 176
                   .|.|..:..:|              |.:|:                    ::.|...|
Mouse   168 -------HQNLIRKFPKG--------------DIISV--------------------EKTVKRCL 191

  Fly   177 VNAFLQLDEEISQEALTSNDVRTMNVALSGAVA-CLVHIEGLQMHVASTGDCGAVLGVLDPQTQQ 240
            ::.|...|||..::|.:......     .|:.| |::.::.: :::|:.||..|:|...:.::|:
Mouse   192 LDTFKHTDEEFLKQASSQKPAWK-----DGSTATCVLAVDNI-LYIANLGDSRAILCRYNEESQK 250

  Fly   241 WHSKKLNIEHNADNMSEVRRILAEHPKEEHETVIRNGRLLSQLAPLRAFGDFRYKWSQEIMQQKV 305
            ..:..|:.|||.....|..||      ::....:|:||:|..|...|:.||.:||          
Mouse   251 HAALSLSKEHNPTQYEERMRI------QKAGGNVRDGRVLGVLEVSRSIGDGQYK---------- 299

  Fly   306 LPMFGVQAMAPNYYTPPYLTARPDVQQHELGPNDKFLVIASDGLWDFLPPSEVVSLVGEHINSKK 370
              ..||             |:.||:::.:|.|||:|:::|.|||:....|.|.|:.:...:...|
Mouse   300 --RCGV-------------TSVPDIRRCQLTPNDRFILLACDGLFKVFTPEEAVNFILSCLEDDK 349

  Fly   371 ILEPMRLPEGDTTLQEISQQLAERKAGLTRKPVDQNAATHLIR 413
            |......|..|...:....:||.:  .:.|...| |....::|
Mouse   350 IQTREGKPAVDARYEAACNRLANK--AVQRGSAD-NVTVMVVR 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdpNP_001245567.1 PP2Cc 58..394 CDD:238083 72/347 (21%)
IlkapNP_075832.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..91
PP2Cc 108..390 CDD:238083 76/367 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.