DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdp and ilkap

DIOPT Version :9

Sequence 1:NP_001245567.1 Gene:Pdp / 31683 FlyBaseID:FBgn0029958 Length:475 Species:Drosophila melanogaster
Sequence 2:XP_012825945.1 Gene:ilkap / 595059 XenbaseID:XB-GENE-1000324 Length:364 Species:Xenopus tropicalis


Alignment Length:309 Identity:63/309 - (20%)
Similarity:114/309 - (36%) Gaps:94/309 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 IFDGHAGAACGQVVSKRLLRYVSAATLPRQVLREQMKQGADSQSFLKCHNDNVDFVSMIKPMYEA 155
            :||||.|....:..::.|                       .|:|:|                  
 Frog   122 VFDGHGGTRASRFAAQNL-----------------------HQNFVK------------------ 145

  Fly   156 SFLKYVNQLLETPQRDVSSE-------LVNAFLQLDEEISQEALTSNDVRTMNVALSGAVACLVH 213
                      :.|:.:.||.       :::||.|.||:..::|.:......     .|..|..|.
 Frog   146 ----------KIPRGEGSSVDKAMKRCILDAFKQTDEDFLKQAASQKPAWK-----DGTTAICVL 195

  Fly   214 IEGLQMHVASTGDCGAVLGVLDPQTQQWHSKKLNIEHNADNMSEVRRILAEHPKEEHETVIRNGR 278
            :....:::|:.||..|:|..::.:.|:.....|:.|||.....|..||      ::....:|:||
 Frog   196 VADNILYIANLGDSRALLCRINKENQKHVVLSLSREHNPTQYEERMRI------QKAGGNVRDGR 254

  Fly   279 LLSQLAPLRAFGDFRYKWSQEIMQQKVLPMFGVQAMAPNYYTPPYLTARPDVQQHELGPNDKFLV 343
            :|..|...|:.||.:||            .:||             .:.|:|::..|..:|:|::
 Frog   255 VLGVLEVSRSIGDGQYK------------RYGV-------------ISTPEVKRCPLTDSDRFIL 294

  Fly   344 IASDGLWDFLPPSEVVSLVGEHINSKKILEPMRLPEGDTTLQEISQQLA 392
            :|.|||:......|.|:.:..|...|........|:.|:..:....:||
 Frog   295 LACDGLFKAFSAEEAVTFILTHTQEKSSPAEDGPPDFDSLYESACHRLA 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdpNP_001245567.1 PP2Cc 58..394 CDD:238083 63/309 (20%)
ilkapXP_012825945.1 PP2Cc 81..362 CDD:238083 63/309 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.