DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdp and ppm1l

DIOPT Version :9

Sequence 1:NP_001245567.1 Gene:Pdp / 31683 FlyBaseID:FBgn0029958 Length:475 Species:Drosophila melanogaster
Sequence 2:XP_004914489.2 Gene:ppm1l / 594892 XenbaseID:XB-GENE-950664 Length:360 Species:Xenopus tropicalis


Alignment Length:388 Identity:85/388 - (21%)
Similarity:131/388 - (33%) Gaps:132/388 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 DAASYVRSNVREFSLNALRLLPQLPQLSPYDVNLVLRENEFVYNFPVDGVIRSYETNQL------ 66
            ||...|:..|.|...|        .:|...||    .|.||...:       .|::|.:      
 Frog    54 DAVQMVKGKVAEMMQN--------ERLGGLDV----LEAEFSKTW-------EYKSNNVAVYSIQ 99

  Fly    67 GSNWPCED---------SRTEASFLHRNGFICGIFDGHAGAACGQVVSKRLLRYVSAATLPRQVL 122
            |.....||         :::..|       |.||||||.|.:..:.|...|          .:||
 Frog   100 GRRDHMEDRFEIITDLVNKSHPS-------IFGIFDGHGGESAAEYVKTHL----------PEVL 147

  Fly   123 REQMKQGADSQSFLKCHNDNVDFVSMIKPMYEASFLKYVNQLLETPQRDVSSELVNAFLQLDEEI 187
            ::.:      |.|   ..|.           |.|.|.| ..:||           ...|.:|.|:
 Frog   148 KQHL------QDF---ERDK-----------ENSVLSY-QTILE-----------QQILAIDREM 180

  Fly   188 SQEALTSNDVRTMNVALSGAVACLVH-IEGLQMHVASTGDCGAVLGVLDPQTQQWHSKKLNIEHN 251
            .::...|.|        .....||:. :...::.||:.||...||...|     .::..|:.:|.
 Frog   181 LEKLSVSYD--------EAGTTCLIALLSDKELTVANVGDSRGVLCDKD-----GNAIPLSHDHK 232

  Fly   252 ADNMSEVRRILAEHPKEEHETVIRNG--RLLSQLAPLRAFGDFRYKWSQEIMQQKVLPMFGVQAM 314
            ...:.|.:||     |.....:..||  |:...||..|:.||:..|....|:....:..|.:..:
 Frog   233 PYQLKERKRI-----KRAGGFISFNGSWRVQGILAMSRSLGDYPLKNLNVIISDPDILSFDLDKL 292

  Fly   315 APNYYTPPYLTARPDVQQHELGPNDKFLVIASDGLWDFLPPSEVVSLVGE-----HINSKKIL 372
            .|                       :|:::|||||||.....|.|..:.|     |..:|.|:
 Frog   293 QP-----------------------EFMILASDGLWDAFSNEEAVRFIKERLDEPHFGAKSIV 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdpNP_001245567.1 PP2Cc 58..394 CDD:238083 73/338 (22%)
ppm1lXP_004914489.2 PP2Cc 93..351 CDD:238083 71/330 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.