DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdp and PPM1H

DIOPT Version :9

Sequence 1:NP_001245567.1 Gene:Pdp / 31683 FlyBaseID:FBgn0029958 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_065751.1 Gene:PPM1H / 57460 HGNCID:18583 Length:514 Species:Homo sapiens


Alignment Length:390 Identity:80/390 - (20%)
Similarity:155/390 - (39%) Gaps:103/390 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 EDSRTEASFLHRNGFICGIFDGHAGAACGQVVSKRLLRYV------------SAATLPRQVLREQ 125
            |:|.:|....|    ...:||||||:....|.|:.|..::            ::|.||...|.|:
Human   135 ENSESEGVSCH----YWSLFDGHAGSGAAVVASRLLQHHITEQLQDIVDILKNSAVLPPTCLGEE 195

  Fly   126 MKQ-GADSQSFLKCHNDNVDFVSMIKPMYEASFLKYVNQLLETP------QRDVSSE------LV 177
            .:. .|:|::..:..:......:...|              .||      ::.:..|      |.
Human   196 PENTPANSRTLTRAASLRGGVGAPGSP--------------STPPTRFFTEKKIPHECLVIGALE 246

  Fly   178 NAFLQLDEEISQEALTSNDVRTMNVALSGAVACLVHIEGL-QMHVASTGDCGAVL---GVLDPQT 238
            :||.::|.:|.:|..:.|        :||....|:.|..| :::||:.||..|::   |.:.|.:
Human   247 SAFKEMDLQIERERSSYN--------ISGGCTALIVICLLGKLYVANAGDSRAIIIRNGEIIPMS 303

  Fly   239 QQW--HSKKLNIEHNADNMSEVRRILAEHPKEEHETVIRNGRLL--SQLAPLRAFGDFRYK-WSQ 298
            .::  .:::..:::.|        .:..|......|.:...|.:  .:|.....:.||... |:.
Human   304 SEFTPETERQRLQYLA--------FMQPHLLGNEFTHLEFPRRVQRKELGKKMLYRDFNMTGWAY 360

  Fly   299 EIMQQ---------------KVLPMFGV---------QAMAPNYYTPPYLTARPDVQQHELGP-- 337
            :.::.               :|:...||         :....|.|..|:|::.|:|:.::|..  
Human   361 KTIEDEDLKFPLIYGEGKKARVMATIGVTRGLGDHDLKVHDSNIYIKPFLSSAPEVRIYDLSKYD 425

  Fly   338 --NDKFLVIASDGLWDFLPPSEVVSLVGEHINSKKILEPMRLPEGDTTLQEISQQLAERKAGLTR 400
              :|..|::|:|||||.|...||...:.:.:.:....:|.|.     ||  .:|.|..|..|:.:
Human   426 HGSDDVLILATDGLWDVLSNEEVAEAITQFLPNCDPDDPHRY-----TL--AAQDLVMRARGVLK 483

  Fly   401  400
            Human   484  483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdpNP_001245567.1 PP2Cc 58..394 CDD:238083 78/382 (20%)
PPM1HNP_065751.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 109..135 80/390 (21%)
PP2Cc 143..507 CDD:238083 77/382 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144735
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.