DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdp and ppm1nb

DIOPT Version :9

Sequence 1:NP_001245567.1 Gene:Pdp / 31683 FlyBaseID:FBgn0029958 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_001096587.1 Gene:ppm1nb / 564875 ZFINID:ZDB-GENE-071004-34 Length:435 Species:Danio rerio


Alignment Length:338 Identity:77/338 - (22%)
Similarity:115/338 - (34%) Gaps:123/338 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 QLG---SNWPCEDSRTEASFLHRNGFICGIFDGHAGAACGQVVSKRLLRYVSAATLPRQVLREQM 126
            |||   |:|        |.|        .:||||||:|..|..|:.||.::....          
Zfish   100 QLGGELSHW--------AFF--------AVFDGHAGSAVAQNCSRNLLDHILGTG---------- 138

  Fly   127 KQGADSQSFLKCHNDNVDFVSMIKPMYEASFLKYVNQLLETPQRDVSSELVNAFLQLDEEISQEA 191
            |..||                                  |..:| |:......|..:|:.:...|
Zfish   139 KIRAD----------------------------------EDVER-VTEGFKEGFFLMDKHLHAMA 168

  Fly   192 LTSNDVRTMNVALSGAVACLVHIEGLQMHVASTGDCGAVL---GVLDPQTQQWHSKKLNIEHNAD 253
            ......|.....:|.|:.  .|    .::..:.||..|||   |.:...|:         :|...
Zfish   169 CREGWERGGTTVVSTAIT--PH----HIYFVNCGDSRAVLCRAGRVAFSTE---------DHKPF 218

  Fly   254 NMSEVRRILAEHPKEEHETVIRNGRLLSQLAPLRAFGDFRYK---WSQEIMQQKVLPMFGVQAMA 315
            :..|..||      |.....:...|:...||..||.|||.||   | :.:.:|.|.|        
Zfish   219 SPGEKERI------ESAGGSVTLQRVNGSLAVSRALGDFSYKTVEW-RSVTEQMVSP-------- 268

  Fly   316 PNYYTPPYLTARPDVQQHELGPNDKFLVIASDGLWDFLPPSEVVSLVGEHINSKKILEPMRLPEG 380
                       .|:|...|..|.|:|||:|.||:||.:...|:.:.|...:   :|.        
Zfish   269 -----------EPEVSVVERSPADEFLVLACDGVWDTVSNEELCAFVHSRL---RIC-------- 311

  Fly   381 DTTLQEISQQLAE 393
             |.|:|:..|:.:
Zfish   312 -TDLREVCSQVID 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdpNP_001245567.1 PP2Cc 58..394 CDD:238083 77/338 (23%)
ppm1nbNP_001096587.1 PP2Cc 79..341 CDD:238083 77/338 (23%)
PP2C_C 335..412 CDD:285117
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577951
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.