DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdp and PPM1G

DIOPT Version :9

Sequence 1:NP_001245567.1 Gene:Pdp / 31683 FlyBaseID:FBgn0029958 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_817092.1 Gene:PPM1G / 5496 HGNCID:9278 Length:546 Species:Homo sapiens


Alignment Length:320 Identity:71/320 - (22%)
Similarity:121/320 - (37%) Gaps:83/320 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 GIFDGHAGAACGQVVSKRLLRYVSAATLPRQVLREQMKQGADSQSFLKCHNDNVDFVSMIKPMYE 154
            ||..|.||.:|.....|          |||          .....|.:...|..|         |
Human   231 GIPTGEAGPSCSSASDK----------LPR----------VAKSKFFEDSEDESD---------E 266

  Fly   155 ASFLKYVNQLLETPQRDVSSELVNAFLQLDEEISQEALTSNDVRTMNVAL------------SGA 207
            |...:..::.....:...|||  .|..:.||:.::||...::.....:.:            ||.
Human   267 AEEEEEDSEECSEEEDGYSSE--EAENEEDEDDTEEAEEDDEEEEEEMMVPGMEGKEEPGSDSGT 329

  Fly   208 VACLVHIEGLQMHVASTGDCGAVLGVLDPQTQQWHSKKLNIEHNADNMSEVRRILAEHPKEEHET 272
            .|.:..|.|.|:.||:.||...|:      ::...:..::.:|..::..|:.||     |.....
Human   330 TAVVALIRGKQLIVANAGDSRCVV------SEAGKALDMSYDHKPEDEVELARI-----KNAGGK 383

  Fly   273 VIRNGRLLSQLAPLRAFGDFRYKWSQEIMQQKVLPMFGVQAMAPNYYTPP---YLTARPDVQQHE 334
            |..:||:...|...||.||..||.::.:                    ||   .::|.||::...
Human   384 VTMDGRVNGGLNLSRAIGDHFYKRNKNL--------------------PPEEQMISALPDIKVLT 428

  Fly   335 LGPNDKFLVIASDGLWDFLPPSEVVSLVGEHINSKKILEPMRLPEGDTTLQEISQQLAER 394
            |..:.:|:|||.||:|:.:...|||..:...|:.:.....:||      |..|.::|.::
Human   429 LTDDHEFMVIACDGIWNVMSSQEVVDFIQSKISQRDENGELRL------LSSIVEELLDQ 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdpNP_001245567.1 PP2Cc 58..394 CDD:238083 71/318 (22%)
PPM1GNP_817092.1 PP2Cc 25..>110 CDD:214625
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..139
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 161..328 23/127 (18%)
PP2Cc <324..505 CDD:238083 48/196 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 512..546
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.