DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdp and PPM1A

DIOPT Version :9

Sequence 1:NP_001245567.1 Gene:Pdp / 31683 FlyBaseID:FBgn0029958 Length:475 Species:Drosophila melanogaster
Sequence 2:XP_016876870.1 Gene:PPM1A / 5494 HGNCID:9275 Length:459 Species:Homo sapiens


Alignment Length:331 Identity:71/331 - (21%)
Similarity:115/331 - (34%) Gaps:100/331 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 EDSRTEA----SFLHRNGFICGIFDGHAGAACGQVVSKRLLRYVSAATLPRQVLREQMKQGADSQ 133
            ||:.|..    |.|....|. .::|||||:...:...:.||.:::                    
Human   114 EDAHTAVIGLPSGLESWSFF-AVYDGHAGSQVAKYCCEHLLDHIT-------------------- 157

  Fly   134 SFLKCHNDNVDFV-SMIKPMYEASFLKYVNQLLETPQRDVSSELVNAFLQLDEEISQEALTSNDV 197
                   :|.||. |...|..|                :|.:.:...||::||.          :
Human   158 -------NNQDFKGSAGAPSVE----------------NVKNGIRTGFLEIDEH----------M 189

  Fly   198 RTMN-----VALSGAVACLVHIEGLQMHVASTGDCGAVLGVLDPQTQQWHSKKLNI---EHNADN 254
            |.|:     ...||:.|..|.|.....:..:.||...:|         ..::|::.   :|...|
Human   190 RVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLL---------CRNRKVHFFTQDHKPSN 245

  Fly   255 MSEVRRILAEHPKEEHETVIRNGRLLSQLAPLRAFGDFRYKWSQEIMQQKVLPMFGVQAMAPNYY 319
            ..|..||      :.....:...|:...||..||.|||.||.              |....|   
Human   246 PLEKERI------QNAGGSVMIQRVNGSLAVSRALGDFDYKC--------------VHGKGP--- 287

  Fly   320 TPPYLTARPDVQQHELG-PNDKFLVIASDGLWDFLPPSEVVSLVGEHINSKKILEPMRLPEGDTT 383
            |...::..|:|...|.. .:|:|:::|.||:||.:...|:...|...:.....||.:.....||.
Human   288 TEQLVSPEPEVHDIERSEEDDQFIILACDGIWDVMGNEELCDFVRSRLEVTDDLEKVCNEVVDTC 352

  Fly   384 LQEISQ 389
            |.:.|:
Human   353 LYKGSR 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdpNP_001245567.1 PP2Cc 58..394 CDD:238083 71/331 (21%)
PPM1AXP_016876870.1 PP2Cc 100..368 CDD:238083 71/331 (21%)
PP2C_C 362..437 CDD:285117
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144769
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.