DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdp and alph

DIOPT Version :9

Sequence 1:NP_001245567.1 Gene:Pdp / 31683 FlyBaseID:FBgn0029958 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_651701.1 Gene:alph / 43481 FlyBaseID:FBgn0086361 Length:374 Species:Drosophila melanogaster


Alignment Length:392 Identity:88/392 - (22%)
Similarity:136/392 - (34%) Gaps:111/392 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 SRTEASFLHRNGF--------ICGIFDGHAGAACGQVVSKRLLRYVSAATLPRQVLREQMKQGAD 131
            |..|.::..|.|.        ...:||||||....:..:|.||..:        :..|:...|  
  Fly    34 SEMEDAYYARAGLGDALPDWSFFAVFDGHAGCKVSEHCAKHLLESI--------ISTEEFIGG-- 88

  Fly   132 SQSFLKCHNDNVDFVSMIKPMYEASFLKYVNQLLETPQRDVSSELVNAFLQLDEEISQEALTSND 196
                        |.|..|:    ..||:....:.|.|:....||                     
  Fly    89 ------------DHVKGIR----TGFLRIDEVMRELPEFTRESE--------------------- 116

  Fly   197 VRTMNVALSGAVACLVHIEGLQMHVASTGDCGAVL---GVLDPQTQQWHSKKLNIE----HNADN 254
                  ...|..|....:...|:::|:.||..|||   ||....||. |...|..|    :||..
  Fly   117 ------KCGGTTAVCAFVGLTQVYIANCGDSRAVLCRQGVPVFATQD-HKPILPEEKERIYNAGG 174

  Fly   255 MSEVRRILAEHPKEEHETVIRNGRLLSQLAPLRAFGDFRYKWSQEIMQQKVLPMFGVQAMAPNYY 319
            ...::|:              ||    .||..||.||:.:|..:|..|.:       |.::|   
  Fly   175 SVMIKRV--------------NG----TLAVSRALGDYDFKNVKEKGQCE-------QLVSP--- 211

  Fly   320 TPPYLTARPDVQQHELGPNDKFLVIASDGLWDFLPPSEVVSLVGEHINSKKILEPMRLPEGDTTL 384
                   .|::.......:|:|||:|.||:||.:...:|.|.:...:.....|..:.....||.|
  Fly   212 -------EPEIFCQSRQDSDEFLVLACDGIWDVMSNEDVCSFIHSRMRVTSNLVSIANQVVDTCL 269

  Fly   385 QEISQQ----LAERKAGLTRKPVDQNAATHLIRHALGG-TDYGIEHSKISYYLTLPRDAVRLYRD 444
            .:.|:.    :.....|..:...:...|.|.:...:.. |...||.|||:.|:.|.:....  ||
  Fly   270 HKGSRDNMSIIIIAFPGAPKPTEEAIEAEHRLEKQIEKITRDEIESSKITDYVDLLKCLQN--RD 332

  Fly   445 DI 446
            ||
  Fly   333 DI 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdpNP_001245567.1 PP2Cc 58..394 CDD:238083 73/337 (22%)
alphNP_651701.1 PP2Cc 24..284 CDD:238083 73/338 (22%)
PP2C_C 278..352 CDD:285117 15/59 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445122
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.