DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdp and CG12091

DIOPT Version :9

Sequence 1:NP_001245567.1 Gene:Pdp / 31683 FlyBaseID:FBgn0029958 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_001261261.1 Gene:CG12091 / 38177 FlyBaseID:FBgn0035228 Length:321 Species:Drosophila melanogaster


Alignment Length:389 Identity:76/389 - (19%)
Similarity:130/389 - (33%) Gaps:134/389 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 GHAGAACGQVVSKRLLRYVSAATLPRQV----------LREQMKQGA-DSQSFLKCHNDNVDFVS 147
            |.:|||.............|.|..||.|          ||.:.|.|. ...|:.|....:.|.:.
  Fly    30 GGSGAAAKGATKSGATPGSSGAPRPRFVSVVCGFAKDNLRHKYKPGKYGEDSWFKASTASADVMG 94

  Fly   148 M-----------IKPMYEASFL-KYVNQLLE----TPQRDVSSELVNAFLQLDEEISQEALTSND 196
            :           |.|...:||| :...:|::    .|||.|:. |..::.:|.|:          
  Fly    95 VADGVGGWRSYGIDPGEFSSFLMRTCERLVQCSHFNPQRPVNL-LAYSYCELMEQ---------- 148

  Fly   197 VRTMNVALSGAVAC--LVHIEGLQMHVASTGDCGAVLGVLDPQTQQWHSKKLNIEHNADNMSEVR 259
               ....|..:.||  :::.|...:|.|:.||.|.|:                          ||
  Fly   149 ---KKPILGSSTACVLILNRETSTVHTANIGDSGFVV--------------------------VR 184

  Fly   260 RILAEHPKEEHETVIRNGRLLSQLAPLRAFGDFRYKWSQEIMQQKVLPMFGVQAMAPNYYTPPYL 324
            .....|..||.:........||                        ||        |..:.|..|
  Fly   185 EGQVVHKSEEQQHYFNTPFQLS------------------------LP--------PPGHGPNVL 217

  Fly   325 TARP---DVQQHELGPNDKFLVIASDGLWDFLPPSEVVSLVGEHINSKKILEPMRLPEGDTTLQE 386
            :..|   |.....:...| .::||:||::|.:|...::.::.| :..::  :|::|.....:|..
  Fly   218 SDSPESADTMSFPVRDGD-VILIATDGVFDNVPEDLMLQVLSE-VEGER--DPVKLQMTANSLAL 278

  Fly   387 ISQQLAERKAGLTRKPVDQNAATHLIRHALGGTDYGIEHSKISYYLTLPRDAVRLYRDDITITV 450
            :::.|:.....|:  |...:|..:.|: |.||..                       ||||:.:
  Fly   279 MARTLSLNSEFLS--PFALSARRNNIQ-ARGGKP-----------------------DDITVVL 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdpNP_001245567.1 PP2Cc 58..394 CDD:238083 65/331 (20%)
CG12091NP_001261261.1 PP2Cc 76..316 CDD:294085 63/341 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.