DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdp and CG10417

DIOPT Version :9

Sequence 1:NP_001245567.1 Gene:Pdp / 31683 FlyBaseID:FBgn0029958 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_610169.1 Gene:CG10417 / 35492 FlyBaseID:FBgn0033021 Length:662 Species:Drosophila melanogaster


Alignment Length:194 Identity:48/194 - (24%)
Similarity:90/194 - (46%) Gaps:33/194 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 DEEISQEALTSNDVRTMNVAL-----SGAVACLVHIEGLQMHVASTGDCGAVLGVLDPQTQQWHS 243
            |||.:.|...:||....|:..     ||..|.:..::|..::||:.||...|:      ::...:
  Fly   366 DEEETDEDQMANDNFCANMIEEPGKDSGCTAVVCLLQGRDLYVANAGDSRCVI------SRSGQA 424

  Fly   244 KKLNIEHNADNMSEVRRILAEHPKEEHETVIRNGRLLSQLAPLRAFGDFRYKWSQEIMQQKVLPM 308
            .:::|:|..::..|..||:....:     |..:||:...|...||.||..||.:..:..::.:  
  Fly   425 IEMSIDHKPEDDEEASRIIKAGGR-----VTLDGRVNGGLNLSRALGDHAYKTNVTLPAEEQM-- 482

  Fly   309 FGVQAMAPNYYTPPYLTARPDVQQHELGPNDKFLVIASDGLWDFLPPSEVVSLVGEHINSKKIL 372
                           ::|.||:::..:.|.|:|:|:|.||:|:::...|||..|...:...|.|
  Fly   483 ---------------ISALPDIKKLIITPEDEFMVLACDGIWNYMSSEEVVEFVRCRLKDNKKL 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdpNP_001245567.1 PP2Cc 58..394 CDD:238083 48/194 (25%)
CG10417NP_610169.1 PP2Cc 18..>100 CDD:214625
PP2Cc <374..564 CDD:238083 44/186 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445112
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13832
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.