DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdp and PPM1J

DIOPT Version :9

Sequence 1:NP_001245567.1 Gene:Pdp / 31683 FlyBaseID:FBgn0029958 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_005158.5 Gene:PPM1J / 333926 HGNCID:20785 Length:505 Species:Homo sapiens


Alignment Length:423 Identity:89/423 - (21%)
Similarity:159/423 - (37%) Gaps:146/423 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 PCEDSRTEASFLHRNGFIC----GIFDGHAGAACGQVVSKRLLRYVSAATLPRQVLREQMKQGAD 131
            |.|.||.:.        :|    |:||||||....::.|:.|.|::          |||:|   |
Human   140 PREPSRGQG--------LCFYYWGLFDGHAGGGAAEMASRLLHRHI----------REQLK---D 183

  Fly   132 SQSFLKCHN-------------DNVDFVSMIKPMYEASFLKYVNQLLETPQRDVSSE------LV 177
            ....|:..:             |:.|...::.|           |...:.|::||.|      :.
Human   184 LVEILQDPSPPPLCLPTTPGTPDSSDPSHLLGP-----------QSCWSSQKEVSHESLVVGAVE 237

  Fly   178 NAFLQLDEEISQEALTSNDVRTMNVALSGAVACLV-HIEGLQMHVASTGDCGAVL---GVL---- 234
            |||..:||::::|       |..:....|..|.:| ::.| :::||:.||..|::   |.:    
Human   238 NAFQLMDEQMARE-------RRGHQVEGGCCALVVIYLLG-KVYVANAGDSRAIIVRNGEIIPMS 294

  Fly   235 ---DPQTQQWHSKKLN------IEHNADNMSEVRRILAEHPKEEHETVI---------------- 274
               .|:|::...:.|.      :.....::...||:|   |||..:.::                
Human   295 REFTPETERQRLQLLGFLKPELLGSEFTHLEFPRRVL---PKELGQRMLYRDQNMTGWAYKKIEL 356

  Fly   275 ------------RNGRLLSQLAPLRAFGDFRYKWSQEIMQQKVLPMFGVQAMAPNYYTPPYLTAR 327
                        :..|:::.:...|..||...|     :....||:            .|:|:..
Human   357 EDLRFPLVCGEGKKARVMATIGVTRGLGDHSLK-----VCSSTLPI------------KPFLSCF 404

  Fly   328 PDVQ-----QHELGPNDKFLVIASDGLWDFLPPSEVVSLVGEHINSKKILEPMRLPEGDTTLQEI 387
            |:|:     |:|..|:| .||:.:|||||.....||.:.|...:::.:       |...:....:
Human   405 PEVRVYDLTQYEHCPDD-VLVLGTDGLWDVTTDCEVAATVDRVLSAYE-------PNDHSRYTAL 461

  Fly   388 SQQLAERKAGLTRKPVDQNAATHLIRHALGGTD 420
            :|.|.....|..|     :....|..:.||..|
Human   462 AQALVLGARGTPR-----DRGWRLPNNKLGSGD 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdpNP_001245567.1 PP2Cc 58..394 CDD:238083 83/395 (21%)
PPM1JNP_005158.5 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..103
PP2Cc 106..498 CDD:238083 89/423 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144764
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.