DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdp and Ppm1h

DIOPT Version :9

Sequence 1:NP_001245567.1 Gene:Pdp / 31683 FlyBaseID:FBgn0029958 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_001103688.1 Gene:Ppm1h / 319468 MGIID:2442087 Length:513 Species:Mus musculus


Alignment Length:397 Identity:81/397 - (20%)
Similarity:153/397 - (38%) Gaps:117/397 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 EDSRTEASFLHRNGFIC---GIFDGHAGAACGQVVSKRLLRYV------------SAATLPRQVL 122
            |:|.:|       |..|   .:||||||:....|.|:.|..::            ::|.||...|
Mouse   134 ENSESE-------GISCHYWSLFDGHAGSGAAVVASRLLQHHITQQLQDIVEILKNSAILPPTCL 191

  Fly   123 REQMKQGADSQSFLKCHNDNVDFVSMIK------------PMYEASFLKYVNQLLETPQRDVSSE 175
            .|:.:.       ...|...:...:.::            |....:..|..::.|      |...
Mouse   192 GEEPES-------TPAHGRTLTRAASLRGGVGAPGSPSTPPTRFFTEKKIPHECL------VIGA 243

  Fly   176 LVNAFLQLDEEISQEALTSNDVRTMNVALSGA-----VACLVHIEGLQMHVASTGDCGAVL---G 232
            |.:||.::|.:|.:|....|        :||.     |.||:.    :::||:.||..|::   |
Mouse   244 LESAFKEMDLQIERERSAYN--------ISGGCTALIVVCLLG----KLYVANAGDSRAIIIRNG 296

  Fly   233 VLDPQTQQW--HSKKLNIEHNADNMSEVRRILAEHPKEEHETVIRNGRLL--SQLAPLRAFGDFR 293
            .:.|.:.::  .:::..:::.|        .:..|......|.:...|.:  .:|.....:.||.
Mouse   297 EIIPMSSEFTPETERQRLQYLA--------FMQPHLLGNEFTHLEFPRRVQRKELGKKMLYRDFN 353

  Fly   294 YK-WSQEIMQQ---------------KVLPMFGV---------QAMAPNYYTPPYLTARPDVQQH 333
            .. |:.:.::.               :|:...||         :....|.|..|:|::.|:|:.:
Mouse   354 MTGWAYKTIEDDDLKFPLIYGEGKKARVMATIGVTRGLGDHDLKVHDSNIYIKPFLSSAPEVRVY 418

  Fly   334 EL-----GPNDKFLVIASDGLWDFLPPSEVVSLVGEHINSKKILEPMRLPEGDTTLQEISQQLAE 393
            :|     |.:| .|::|:|||||.|...||...:.:.:.:....:|.|.     ||  .:|.|..
Mouse   419 DLSRYEHGADD-VLILATDGLWDVLSNEEVAEAITQFLPNCDPDDPHRY-----TL--AAQDLVM 475

  Fly   394 RKAGLTR 400
            |..|:.:
Mouse   476 RARGVLK 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdpNP_001245567.1 PP2Cc 58..394 CDD:238083 79/389 (20%)
Ppm1hNP_001103688.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 109..133
PP2Cc 142..506 CDD:238083 77/382 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834847
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.