DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdp and CG15035

DIOPT Version :9

Sequence 1:NP_001245567.1 Gene:Pdp / 31683 FlyBaseID:FBgn0029958 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_572396.1 Gene:CG15035 / 31673 FlyBaseID:FBgn0029949 Length:374 Species:Drosophila melanogaster


Alignment Length:194 Identity:43/194 - (22%)
Similarity:64/194 - (32%) Gaps:79/194 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   273 VIRNGRLLSQLAPLRAFGDFRYKWSQEIMQQKVLPMFGVQAMAPNYYTPPYLTARP----DVQQH 333
            |:|:|:::.:              |||...|               :..||..|.|    |....
  Fly   236 VVRSGKVVCR--------------SQEQQHQ---------------FNTPYQLASPPPGYDFDAV 271

  Fly   334 ELGPND-----------KFLVIASDGLWDFLPPSEVVSLVGEHINSKKILEPMRLPEGDTTLQEI 387
            ..||..           ..:::|:||::|.:|.|.:|.::.|   ...|..|:||.....|:   
  Fly   272 SDGPESADTIQFPMQLGDVILLATDGVYDNVPESFLVEVLTE---MSGISNPVRLQMAANTV--- 330

  Fly   388 SQQLAERKAGLTRK---PVDQNAATHLIRHALGGTDYGIEHSKISYYLTLPRDAVRLYRDDITI 448
              .|..|....:.|   |..|||..|.| .|.||..                       ||||:
  Fly   331 --ALMARTLSFSPKHDSPFSQNARKHDI-DAWGGKP-----------------------DDITV 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdpNP_001245567.1 PP2Cc 58..394 CDD:238083 28/135 (21%)
CG15035NP_572396.1 PP2Cc 133..371 CDD:294085 43/194 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.