DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdp and Pp2d1

DIOPT Version :9

Sequence 1:NP_001245567.1 Gene:Pdp / 31683 FlyBaseID:FBgn0029958 Length:475 Species:Drosophila melanogaster
Sequence 2:XP_038939402.1 Gene:Pp2d1 / 316157 RGDID:1564811 Length:651 Species:Rattus norvegicus


Alignment Length:519 Identity:105/519 - (20%)
Similarity:176/519 - (33%) Gaps:176/519 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 YNFPVDGVIRSYETNQLGSNWPCEDSRTEASFLHRNGF-----IC--GIFDGHAGAACGQVVSKR 107
            |:..:.|:.....:|   |.|..|.:   ..|...|.|     :|  |:||.|.|.|...:.||.
  Rat   194 YHLLIKGIAICSNSN---STWKAEPN---CKFTVVNDFGDKANVCFFGLFDSHHGYAAADLASKE 252

  Fly   108 ----LLRYVSAATLPRQVLREQMKQGADSQSFLKCHNDNVDFVSMIKPMYEA--SFLKYVNQLLE 166
                ||..:|......|:..||       |..:.      .|.::.:..|.|  .......:...
  Rat   253 FQVLLLHQLSVQDPSYQMTAEQ-------QDLIN------SFHTVFREEYRAREEAFSSTYKTFR 304

  Fly   167 TPQR---DVSSELVNAFLQLDEEISQEALTSNDVRTMNVALSGAVACLVH--------------- 213
            |.:|   ||......||.::|..:   .|..|:|..:..:...|:.|::.               
  Rat   305 TNKREYEDVHKAFAKAFWRMDRLL---RLGRNEVSRVRWSGCSALTCILEGGIKNPQATKDWEKT 366

  Fly   214 ----------------IEGLQMHVASTGDCGAVLGVLDPQTQQWHSKKLNIEHNADNMSEVRRIL 262
                            |.|: :|:|:.|:..|||      .:......|..||...|..|.||:|
  Rat   367 YQHGVNSSPFQKIPQIISGV-LHIANAGNVQAVL------CRNGKGFCLTKEHTTRNTKERRRVL 424

  Fly   263 -------AEHPKEEHETVIRNGRLLSQLAPLRAFGDFRYKWSQEIMQQKVLPMFGVQAMAPNYYT 320
                   ::.|....:..|:..|.|.....||             :::.::|:       |...:
  Rat   425 YSEVGISSDDPYGLLDGHIKTTRGLGFHGNLR-------------LKKAIIPV-------PQTIS 469

  Fly   321 PPYLTARPDVQQHELGPNDKFLVIASDGLWDFLPPSEVVSLV----------------GEHINSK 369
            .|.    .|:.|        ||::|::|||..|...||.:||                .:...||
  Rat   470 VPI----DDLCQ--------FLILATNGLWQVLDKKEVTALVITLFHAYKETCVSGPRNKPWPSK 522

  Fly   370 KILEP----MRL-----PEGD--TTLQEISQQLAERKAGLTRKPVDQNAATHLIRHALGGTDYGI 423
            .:|.|    :|:     ||.:  |:..::.::|::.....|....|.:|.|.|.:    .|.|..
  Rat   523 SLLFPPDSNIRVLFQYQPENEDITSTTDVMKRLSDSPFADTNIHQDTSAETFLPK----ATSYDP 583

  Fly   424 EHSKISYYLTLPRD--------AVRLY---------------------RDDITITVIYFN-SEH 457
            ..:|.|..|.....        .::.:                     ||.||:.|::.| ||:
  Rat   584 YSTKESNSLPTTNSKQESEKEICIKNFYKGAAEYIGCQLVSAAIEGGSRDSITVMVMFLNGSEY 647

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdpNP_001245567.1 PP2Cc 58..394 CDD:238083 85/416 (20%)
Pp2d1XP_038939402.1 PP2Cc 214..499 CDD:238083 71/342 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338467
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.