DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdp and Ppm1h

DIOPT Version :9

Sequence 1:NP_001245567.1 Gene:Pdp / 31683 FlyBaseID:FBgn0029958 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_001258008.1 Gene:Ppm1h / 314897 RGDID:1309528 Length:513 Species:Rattus norvegicus


Alignment Length:396 Identity:80/396 - (20%)
Similarity:151/396 - (38%) Gaps:115/396 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 EDSRTEASFLHRNGFIC---GIFDGHAGAACGQVVSKRLLRYV------------SAATLPRQVL 122
            |:|.:|       |..|   .:||||||:....|.|:.|..::            ::|.||...|
  Rat   134 ENSESE-------GISCHYWSLFDGHAGSGAAVVASRLLQHHITQQLQDIVEILKNSAILPPTCL 191

  Fly   123 REQMKQGADSQSFLKCHNDNVDFVSMIK------------PMYEASFLKYVNQLLETPQRDVSSE 175
            .|:.:.       ...|...:...:.::            |....:..|..::.|      |...
  Rat   192 GEEPES-------TPAHGRTLTRAASLRGGVGAPGSPSTPPTRFFTEKKIPHECL------VIGA 243

  Fly   176 LVNAFLQLDEEISQEALTSNDVRTMNVALSGA-----VACLVHIEGLQMHVASTGDCGAVL---G 232
            |.:||.::|.:|.:|....|        :||.     |.||:.    :::||:.||..|::   |
  Rat   244 LESAFKEMDLQIERERSAYN--------ISGGCTALIVVCLLG----KLYVANAGDSRAIIIRNG 296

  Fly   233 VLDPQTQQW--HSKKLNIEHNADNMSEVRRILAEHPKEEHETVIRNGRLL--SQLAPLRAFGDFR 293
            .:.|.:.::  .:::..:::.|        .:..|......|.:...|.:  .:|.....:.||.
  Rat   297 EIIPMSSEFTPETERQRLQYLA--------FMQPHLLGNEFTHLEFPRRVQRKELGKKMLYRDFN 353

  Fly   294 YK-WSQEIMQQ---------------KVLPMFGV---------QAMAPNYYTPPYLTARPDVQQH 333
            .. |:.:.::.               :|:...||         :....|.|..|:|::.|:|:.:
  Rat   354 MTGWAYKTIEDDDLKFPLIYGEGKKARVMATIGVTRGLGDHDLKVHDSNIYIKPFLSSAPEVRVY 418

  Fly   334 ELGP----NDKFLVIASDGLWDFLPPSEVVSLVGEHINSKKILEPMRLPEGDTTLQEISQQLAER 394
            :|..    .|..|::|:|||||.|...||...:.:.:.:....:|.|.     ||  .:|.|..|
  Rat   419 DLSKYEHGADDVLILATDGLWDVLSNEEVAEAITQFLPNCDPDDPHRY-----TL--AAQDLVMR 476

  Fly   395 KAGLTR 400
            ..|:.:
  Rat   477 ARGVLK 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdpNP_001245567.1 PP2Cc 58..394 CDD:238083 78/388 (20%)
Ppm1hNP_001258008.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 110..133
PP2Cc 142..506 CDD:238083 76/381 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338430
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.