DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdp and Pptc7

DIOPT Version :9

Sequence 1:NP_001245567.1 Gene:Pdp / 31683 FlyBaseID:FBgn0029958 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_001100611.1 Gene:Pptc7 / 304488 RGDID:1310383 Length:307 Species:Rattus norvegicus


Alignment Length:330 Identity:61/330 - (18%)
Similarity:107/330 - (32%) Gaps:124/330 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 AGAACGQVVSKRLLRYVSAATLPRQVLREQMKQGADSQSFLKCHNDNVDFVSMIKPMYEASFLKY 160
            ||...|:...|.||                 |:||       |:.|:..||:..:   .|..|..
  Rat    42 AGCGFGKDFRKGLL-----------------KKGA-------CYGDDACFVARHR---SADVLGV 79

  Fly   161 VNQLLETPQRDVS---SELVNAFLQLDEEISQEA--LTSNDVRTMNVALSGAVACLVHIEGLQMH 220
            .:.:  ...||..   |:.....::..|.:.:|.  :.||.|..:..:         :.|.||..
  Rat    80 ADGV--GGWRDYGVDPSQFSGTLMRTCERLVKEGRFVPSNPVGILTTS---------YCELLQNK 133

  Fly   221 VASTGDCGAVLGVLDPQTQQWHSKKLNIEHNADNMSEVRRILAEHPKEEHETVIRNGRLLSQLAP 285
            |...|...|.:.|||..:.:.|:..|.                    :....|:|.|.::.:   
  Rat   134 VPLLGSSTACIVVLDRSSHRLHTANLG--------------------DSGFLVVRGGEVVHR--- 175

  Fly   286 LRAFGDFRYKWSQEIMQQKVLPMFGVQAMAPNYYTPPY-------------LTARPDVQQH---- 333
                       |.|  ||             :|:..|:             |:..||....    
  Rat   176 -----------SDE--QQ-------------HYFNTPFQLSIAPPEAEGVVLSDSPDAADSTSFD 214

  Fly   334 -ELGPNDKFLVIASDGLWDFLPPSEVVSLVGEHINSKKILEPMRLPEGDTTLQEISQQLAERKAG 397
             :||   ..::.|:|||:|.:|...::..:.:..||..           .::|..::.:||:...
  Rat   215 VQLG---DIILTATDGLFDNMPDYMILQELKKLKNSNY-----------ESIQRTARSIAEQAHE 265

  Fly   398 LTRKP 402
            |...|
  Rat   266 LAYDP 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdpNP_001245567.1 PP2Cc 58..394 CDD:238083 58/320 (18%)
Pptc7NP_001100611.1 PP2Cc 63..299 CDD:412173 51/285 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.