DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdp and Ppm1j

DIOPT Version :9

Sequence 1:NP_001245567.1 Gene:Pdp / 31683 FlyBaseID:FBgn0029958 Length:475 Species:Drosophila melanogaster
Sequence 2:XP_008759602.1 Gene:Ppm1j / 295341 RGDID:1359104 Length:522 Species:Rattus norvegicus


Alignment Length:411 Identity:88/411 - (21%)
Similarity:161/411 - (39%) Gaps:140/411 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 HRNGF---ICGIFDGHAGAACGQVVSKRLLRYVSAATLPRQVLREQMKQGADSQSFLKCHNDNVD 144
            |..||   ..|:||||||....::.|:.|.|::          |||:|                |
  Rat   162 HNQGFSFYYWGLFDGHAGGGAAEMASRLLHRHI----------REQLK----------------D 200

  Fly   145 FVSMIK-----PMYEASF-----LKYVNQLLE----TPQRDVSSE------LVNAFLQLDEEISQ 189
            .|.:::     |:...|.     :...:||:.    :||::|:.:      :.|||..:||::::
  Rat   201 LVEILQDPLPPPLCLPSTPGTPGVSSPSQLVSPQSWSPQKEVTHDSLVVGAIENAFQLMDEQMAR 265

  Fly   190 EALTSNDVRTMNVALSGAVA-CLVHIEGLQMHVASTGDCGAVL---GVL-------DPQTQQWHS 243
            |       |..::...|..| .:|::.| :|:||:.||..|::   |.:       .|:|::...
  Rat   266 E-------RRGHLVEGGCCALVVVYLLG-KMYVANAGDSRAIIVRNGEIIPMSREFTPETERQRL 322

  Fly   244 KKLN------IEHNADNMSEVRRILAEHPKEEHETVI---------------------------- 274
            :.|.      :.....::...||:   .|||..:.::                            
  Rat   323 QLLGFLKPELLGSEFTHLEFPRRV---QPKELGQRMLYRDQNMTGWAYKKIELEDLRFPLVCGEG 384

  Fly   275 RNGRLLSQLAPLRAFGDFRYKWSQEIMQQKVLPMFGVQAMAPNYYTPPYLTARPDVQ-----QHE 334
            :..|:::.:...|..||...|     :....||:            .|:|:..|:|:     |:|
  Rat   385 KKARVMATIGVTRGLGDHNLK-----VCSSTLPI------------KPFLSCFPEVRVYDLTQYE 432

  Fly   335 LGPNDKFLVIASDGLWDFLPPSEVVSLVGEHINSKKILEPMRLPEGDTTLQEISQQLAERKAGLT 399
            ..|:| .||:.:|||||....|||.:.|...:::.:..:|.|       ...::|.|.....|:.
  Rat   433 HCPDD-VLVLGTDGLWDVTNDSEVAATVDRVLSTYEPNDPSR-------YTALAQALVLGARGIP 489

  Fly   400 RKPVDQNAATHLIRHALGGTD 420
            |     :....|..:.||..|
  Rat   490 R-----DRGWRLPNNKLGSGD 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdpNP_001245567.1 PP2Cc 58..394 CDD:238083 82/383 (21%)
Ppm1jXP_008759602.1 PP2Cc 123..514 CDD:238083 88/411 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338459
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.