DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdp and Ppm1f

DIOPT Version :9

Sequence 1:NP_001245567.1 Gene:Pdp / 31683 FlyBaseID:FBgn0029958 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_786931.1 Gene:Ppm1f / 287931 RGDID:631363 Length:450 Species:Rattus norvegicus


Alignment Length:359 Identity:71/359 - (19%)
Similarity:112/359 - (31%) Gaps:133/359 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 LHRNGFICGIFDGHAGAACGQVVSKRLLRYVSAATLPRQVLREQMKQGADSQSFLKCHNDNVDFV 146
            :||..|  .:||||.|....:..|..:  :.:|:..|                            
  Rat   185 VHRAYF--AVFDGHGGVDAARYASVHV--HTNASHQP---------------------------- 217

  Fly   147 SMIKPMYEASFLKYVNQLLETPQRDVSSELVNAFLQLDEEISQEALTSNDVRTMNVALSGAVACL 211
                            :||..|    ::.|..||...|:...|:|....       ..||.....
  Rat   218 ----------------ELLTDP----AAALKEAFRHTDQMFLQKAKRER-------LQSGTTGVC 255

  Fly   212 VHIEGLQMHVASTGDCGAVLGVLDPQTQQWHSKKLNIEHNADNMSEVRRILAEHPKEEHETVIRN 276
            ..|.|..:|||..||...:|      .||....||...|..:...|..||.|   .....:::..
  Rat   256 ALITGAALHVAWLGDSQVIL------VQQGQVVKLMEPHKPERQDEKSRIEA---LGGFVSLMDC 311

  Fly   277 GRLLSQLAPLRAFGDFRYKWSQEIMQQKVLPMFGVQAMAPNYYTPPYLTARPDVQQHELGPNDKF 341
            .|:...||..||.||                          .:..||::...|....||...:.:
  Rat   312 WRVNGTLAVSRAIGD--------------------------VFQKPYVSGEADAASRELTGLEDY 350

  Fly   342 LVIASDGLWDFLPPSEVVSLVGEHINSKK-----------------------------ILEPMRL 377
            |::|.||.:|.:|..|:..||..|:..:|                             :.:|:.|
  Rat   351 LLLACDGFFDVVPHHEIPGLVHGHLLRQKGSGMHVAEELVAVARDRGSHDNITVMVVFLRDPLEL 415

  Fly   378 PEG----------DTTLQEISQQLAERKAGLTRK 401
            .||          |...|::|..|:|.:...:::
  Rat   416 LEGGGQGAGGAQADVGSQDLSTGLSELEINTSQR 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdpNP_001245567.1 PP2Cc 58..394 CDD:238083 70/350 (20%)
Ppm1fNP_786931.1 PP2C 151..402 CDD:395385 62/310 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 420..450 5/30 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338461
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.