DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdp and Ppm1d

DIOPT Version :9

Sequence 1:NP_001245567.1 Gene:Pdp / 31683 FlyBaseID:FBgn0029958 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_001099295.2 Gene:Ppm1d / 287585 RGDID:1305460 Length:598 Species:Rattus norvegicus


Alignment Length:358 Identity:81/358 - (22%)
Similarity:131/358 - (36%) Gaps:116/358 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 CEDSRTEASFLHRNGFICGIFDGHAGAACGQVVSKRLLRYVS-----AATLPRQVLREQMKQGAD 131
            |...|:..:|.       .:.|||.|....|...:.|..::.     .::.|.:|.      .|.
  Rat    84 CCRRRSSVAFF-------AVCDGHGGREAAQFAREHLWGFIKKQKGFTSSEPAKVC------AAI 135

  Fly   132 SQSFLKCHNDNVDFVSMIKPMYEASFLKYVNQLLETPQRDVSSELVNAFLQLDEEISQEALTSND 196
            .:.||.||      ::|.|            :|.|.|                            
  Rat   136 RKGFLACH------LAMWK------------KLAEWP---------------------------- 154

  Fly   197 VRTMN--VALSGAVACLVHIEGLQMHVASTGDCGAVLGVLDP---------QTQQWHSKKLNIEH 250
             :||.  .:.||..|.:|.|.|::|:||..||.|.|||:.|.         :..|.|..:|..|.
  Rat   155 -KTMTGLPSTSGTTASVVIIRGMKMYVAHVGDSGVVLGIQDDPKDDFVRAVEVTQDHKPELPKER 218

  Fly   251 --------NADNMSEVRRILAEHPKEEHETVIRNGRLLSQ---LAPLRAFGDFRYKWSQEIMQQK 304
                    :..|.|.|.|::.:.|:..|...:|...::.|   ||..||.||.   ||.:....|
  Rat   219 ERIEGLGGSVMNKSGVNRVVWKRPRLTHSGPVRRSTVIDQIPFLAVARALGDL---WSYDFFSGK 280

  Fly   305 VLPMFGVQAMAPNYYTPPYLTARPDVQQHELGP-NDKFLVIASDGLWDFLPPSEVVSLVGEHINS 368
            .:                 ::..||...|.|.| ..|::::.|||||:.:||.:.:|:..:....
  Rat   281 FV-----------------VSPEPDTSVHTLDPQKHKYIILGSDGLWNMVPPQDAISMCQDQEEK 328

  Fly   369 KKILEPMRLPEGDTTLQEISQQLAERKAGLTRK 401
            |.::       |:.. |..::.|..|..|..|:
  Rat   329 KYLM-------GEQG-QSCAKMLVNRALGRWRQ 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdpNP_001245567.1 PP2Cc 58..394 CDD:238083 78/349 (22%)
Ppm1dNP_001099295.2 PP2C 84..361 CDD:278884 81/358 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.