DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdp and Ppm1b

DIOPT Version :9

Sequence 1:NP_001245567.1 Gene:Pdp / 31683 FlyBaseID:FBgn0029958 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_001257548.1 Gene:Ppm1b / 24667 RGDID:3374 Length:465 Species:Rattus norvegicus


Alignment Length:286 Identity:65/286 - (22%)
Similarity:103/286 - (36%) Gaps:77/286 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 IFDGHAGAACGQVVSKRLLRYVSAATLPRQVLREQMKQGADSQSFLKCHNDNVDFVSMIKPMYEA 155
            ::|||||:......|..||.:::.                           |.||.:..|..:  
  Rat    58 VYDGHAGSRVANYCSTHLLEHITT---------------------------NEDFRAADKSGF-- 93

  Fly   156 SFLKYVNQLLETPQRDVSSELVNAFLQLDEEISQEALTSNDVRTMNVALSGAVACLVHIEGLQMH 220
                    .||....:|.:.:...||::||.:.    ..:|:|. .:..||:.|..|.|....::
  Rat    94 --------ALEPSVENVKTGIRTGFLKIDEYMR----NFSDLRN-GMDRSGSTAVGVMISPTHIY 145

  Fly   221 VASTGDCGAVL---GVLDPQTQQWHSKKLNIEHNADNMSEVRRILAEHPKEEHETVIRNGRLLSQ 282
            ..:.||..|||   |.:...||         :|...|..|..||      :.....:...|:...
  Rat   146 FINCGDSRAVLCRNGQVCFSTQ---------DHKPCNPMEKERI------QNAGGSVMIQRVNGS 195

  Fly   283 LAPLRAFGDFRYKWSQEIMQQKVLPMFGVQAMAPNYYTPPYLTARPDVQQHELGPNDKFLVIASD 347
            ||..||.||:.||.              |....|   |...::..|:|.:......|:|:|:|.|
  Rat   196 LAVSRALGDYDYKC--------------VDGKGP---TEQLVSPEPEVYEILRAEEDEFVVLACD 243

  Fly   348 GLWDFLPPSEVVSLVGEHINSKKILE 373
            |:||.:...|:...|...:.....||
  Rat   244 GIWDVMSNEELCEFVNSRLEVSDDLE 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdpNP_001245567.1 PP2Cc 58..394 CDD:238083 65/286 (23%)
Ppm1bNP_001257548.1 PP2Cc 23..295 CDD:238083 65/286 (23%)
PP2C_C 289..365 CDD:285117
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338466
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.