DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdp and Ppm1a

DIOPT Version :9

Sequence 1:NP_001245567.1 Gene:Pdp / 31683 FlyBaseID:FBgn0029958 Length:475 Species:Drosophila melanogaster
Sequence 2:XP_038967714.1 Gene:Ppm1a / 24666 RGDID:3373 Length:455 Species:Rattus norvegicus


Alignment Length:331 Identity:71/331 - (21%)
Similarity:115/331 - (34%) Gaps:100/331 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 EDSRTEA----SFLHRNGFICGIFDGHAGAACGQVVSKRLLRYVSAATLPRQVLREQMKQGADSQ 133
            ||:.|..    |.|....|. .::|||||:...:...:.||.:::                    
  Rat   110 EDAHTAVIGLPSGLETWSFF-AVYDGHAGSQVAKYCCEHLLDHIT-------------------- 153

  Fly   134 SFLKCHNDNVDFV-SMIKPMYEASFLKYVNQLLETPQRDVSSELVNAFLQLDEEISQEALTSNDV 197
                   :|.||. |...|..|                :|.:.:...||::||.          :
  Rat   154 -------NNQDFKGSAGAPSVE----------------NVKNGIRTGFLEIDEH----------M 185

  Fly   198 RTMN-----VALSGAVACLVHIEGLQMHVASTGDCGAVLGVLDPQTQQWHSKKLNI---EHNADN 254
            |.|:     ...||:.|..|.|.....:..:.||...:|         ..::|::.   :|...|
  Rat   186 RVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLL---------CRNRKVHFFTQDHKPSN 241

  Fly   255 MSEVRRILAEHPKEEHETVIRNGRLLSQLAPLRAFGDFRYKWSQEIMQQKVLPMFGVQAMAPNYY 319
            ..|..||      :.....:...|:...||..||.|||.||.              |....|   
  Rat   242 PLEKERI------QNAGGSVMIQRVNGSLAVSRALGDFDYKC--------------VHGKGP--- 283

  Fly   320 TPPYLTARPDVQQHELG-PNDKFLVIASDGLWDFLPPSEVVSLVGEHINSKKILEPMRLPEGDTT 383
            |...::..|:|...|.. .:|:|:::|.||:||.:...|:...|...:.....||.:.....||.
  Rat   284 TEQLVSPEPEVHDIERSEEDDQFIILACDGIWDVMGNEELCDFVRSRLEVTDDLEKVCNEVVDTC 348

  Fly   384 LQEISQ 389
            |.:.|:
  Rat   349 LYKGSR 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdpNP_001245567.1 PP2Cc 58..394 CDD:238083 71/331 (21%)
Ppm1aXP_038967714.1 PP2Cc 96..364 CDD:238083 71/331 (21%)
PP2C_C 358..436 CDD:400262
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338464
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.