DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdp and PPM1E

DIOPT Version :9

Sequence 1:NP_001245567.1 Gene:Pdp / 31683 FlyBaseID:FBgn0029958 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_055721.3 Gene:PPM1E / 22843 HGNCID:19322 Length:755 Species:Homo sapiens


Alignment Length:401 Identity:79/401 - (19%)
Similarity:121/401 - (30%) Gaps:160/401 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 EDSRTEASFLHRNGFICGIFDGHAGAACGQVVSKRLLRYVSAATLPRQVLREQMKQGADSQSFLK 137
            ||...:|.|        .:||||.|              |.||                      
Human   261 EDQEEQAYF--------AVFDGHGG--------------VDAA---------------------- 281

  Fly   138 CHNDNVDFVSMIKPMYEASFLKYVNQL-LETPQRDVSSELVNAFLQLDEEISQEALTSNDVRTMN 201
                          :| ||...:||.: .|....|.:..|..||...||...|:|...:      
Human   282 --------------IY-ASIHLHVNLVRQEMFPHDPAEALCRAFRVTDERFVQKAARES------ 325

  Fly   202 VALSGAVACLVHIEGLQMHVASTGDCGAVLGVLDPQTQQWHSKKLNIEHNADNMSEVRRILAEHP 266
             ...|....:..|.|..:|||..||...:|      .::..:.:|...|..|...|.:||.|   
Human   326 -LRCGTTGVVTFIRGNMLHVAWVGDSQVML------VRKGQAVELMKPHKPDREDEKQRIEA--- 380

  Fly   267 KEEHETVIRNG--RLLSQLAPLRAFGDFRYKWSQEIMQQKVLPMFGVQAMAPNYYTPPYLTARPD 329
              ....|:..|  |:...|:..||.||..:|                          ||:....|
Human   381 --LGGCVVWFGAWRVNGSLSVSRAIGDAEHK--------------------------PYICGDAD 417

  Fly   330 VQQHELGPNDKFLVIASDGLWDFLPPSEVVSLVGEHINSKKILEPMRLPEGDTTLQEISQQLAER 394
            .....|...:.:|::|.||.:|.:.|.|.|.:|.:|:.                           
Human   418 SASTVLDGTEDYLILACDGFYDTVNPDEAVKVVSDHLK--------------------------- 455

  Fly   395 KAGLTRKPVDQNAATHLIRHALGGTDYGIEHSKISYYLTLPRDAVRLYRDDITITVIYFNSEHIA 459
                     :.|..:.::.|.|               :...|||..  .|:||:.|::....:.|
Human   456 ---------ENNGDSSMVAHKL---------------VASARDAGS--SDNITVIVVFLRDMNKA 494

  Fly   460 -KLHSDVDQTE 469
             .:..:.|.||
Human   495 VNVSEESDWTE 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdpNP_001245567.1 PP2Cc 58..394 CDD:238083 65/323 (20%)
PPM1ENP_055721.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 21..131
11 X 2 AA tandem repeats of P-E 31..52
PP2Cc 230..488 CDD:238083 75/382 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 498..537 3/8 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144774
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.