DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdp and Ppm1g

DIOPT Version :9

Sequence 1:NP_001245567.1 Gene:Pdp / 31683 FlyBaseID:FBgn0029958 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_032040.1 Gene:Ppm1g / 14208 MGIID:106065 Length:542 Species:Mus musculus


Alignment Length:314 Identity:69/314 - (21%)
Similarity:121/314 - (38%) Gaps:74/314 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 GIFDGHAGAACGQVVSKRLLRYVSAATLPRQVLREQMKQGADSQSFLKCHNDNVDFVSMIKPMYE 154
            |...|.||.:|.....|          |||....:..:...|....::...|:.:..|..:..|.
Mouse   231 GTATGEAGPSCSSASDK----------LPRVAKSKFFEDSEDESDEVEEEEDDSEECSEDEDGYS 285

  Fly   155 ASFLKYVNQLLETPQRDVSSELVNAFLQLDEEISQEALTSNDVRTMNVAL---------SGAVAC 210
                              |.|..|   :.||:.::||...:|...|...:         ||..|.
Mouse   286 ------------------SEEAEN---EEDEDDTEEAEEDDDEEMMVPGMEGKEEPGSDSGTTAV 329

  Fly   211 LVHIEGLQMHVASTGDCGAVLGVLDPQTQQWHSKKLNIEHNADNMSEVRRILAEHPKEEHETVIR 275
            :..|.|.|:.||:.||...|:      ::...:..::.:|..::..|:.||     |.....|..
Mouse   330 VALIRGKQLIVANAGDSRCVV------SEAGKALDMSYDHKPEDEVELARI-----KNAGGKVTM 383

  Fly   276 NGRLLSQLAPLRAFGDFRYKWSQEIMQQKVLPMFGVQAMAPNYYTPPYLTARPDVQQHELGPNDK 340
            :||:...|...||.||..||.::.:..|:.:                 ::|.||::...|..:.:
Mouse   384 DGRVNGGLNLSRAIGDHFYKRNKNLPPQEQM-----------------ISALPDIKVLTLTDDHE 431

  Fly   341 FLVIASDGLWDFLPPSEVVSLVGEHINSKKILEPMRLPEGDTTLQEISQQLAER 394
            |:|||.||:|:.:...|||..:...|:.:.....:||      |..|.::|.::
Mouse   432 FMVIACDGIWNVMSSQEVVDFIQSKISQRDENGELRL------LSSIVEELLDQ 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdpNP_001245567.1 PP2Cc 58..394 CDD:238083 69/312 (22%)
Ppm1gNP_032040.1 PP2Cc 25..>110 CDD:214625
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 117..136
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 164..325 22/124 (18%)
PP2Cc <321..502 CDD:238083 47/193 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 513..542
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.