DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdp and TAB1

DIOPT Version :9

Sequence 1:NP_001245567.1 Gene:Pdp / 31683 FlyBaseID:FBgn0029958 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_006107.1 Gene:TAB1 / 10454 HGNCID:18157 Length:504 Species:Homo sapiens


Alignment Length:447 Identity:97/447 - (21%)
Similarity:161/447 - (36%) Gaps:168/447 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 RSYETNQLGS-NWPCEDS----RTEASFLHRNGFICGIFDGHAGAACGQVVSKRLLRYVSAATLP 118
            |||..:..|: :.|.|||    |:|     .|.|:.|:|:|:.|......|::||    ||..|.
Human    35 RSYSADGKGTESHPPEDSWLKFRSE-----NNCFLYGVFNGYDGNRVTNFVAQRL----SAELLL 90

  Fly   119 RQV--------LREQMKQGAD--SQSFLKCHNDNVDFVSMIKPMYEASFLKYVNQLLE-TPQRDV 172
            .|:        :|..:.|..|  .:|||:..:|         .:.|.:.|:  :||.| .||..:
Human    91 GQLNAEHAEADVRRVLLQAFDVVERSFLESIDD---------ALAEKASLQ--SQLPEGVPQHQL 144

  Fly   173 S---SELVNAFLQLDEEISQEA------LTSNDVRTMNVALSGAVACLVHIEGLQMHVASTGDCG 228
            .   .:::.....|:.|||..|      |.:|.:...||..:.|:.|...::|||:         
Human   145 PPQYQKILERLKTLEREISGGAMAVVAVLLNNKLYVANVGTNRALLCKSTVDGLQV--------- 200

  Fly   229 AVLGVLDPQTQQWHSKKLNIEHNADNMSEVRRILAEHPKEEHETVIRNGRLLSQLA--------- 284
                     ||      ||::|..:|..|:.|                   ||||.         
Human   201 ---------TQ------LNVDHTTENEDELFR-------------------LSQLGLDAGKIKQV 231

  Fly   285 -------PLRAFGDFRYKWSQEIMQQKVLPMFGVQAMAPNYYTPPYLTARPDVQQHELGPND--- 339
                   ..|..||::.|:...          .:..::.....|  :.|.|::  |...|.|   
Human   232 GIICGQESTRRIGDYKVKYGYT----------DIDLLSAAKSKP--IIAEPEI--HGAQPLDGVT 282

  Fly   340 KFLVIASDGLWDFLPPS--------EVVSLVGEHINSKKILEPMRLPEGDTTLQEISQQLAERKA 396
            .|||:.|:||:..|..:        |:.:::......:            |:|..::|.:     
Human   283 GFLVLMSEGLYKALEAAHGPGQANQEIAAMIDTEFAKQ------------TSLDAVAQAV----- 330

  Fly   397 GLTRKPVDQNAATHLIRHALGGTDYGIEHSKISYYLTLPRDAVRLYRDDITITVIYF 453
                  ||:....|....|.||     |.::.     .||      .:|:|:.|..|
Human   331 ------VDRVKRIHSDTFASGG-----ERARF-----CPR------HEDMTLLVRNF 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdpNP_001245567.1 PP2Cc 58..394 CDD:238083 84/386 (22%)
TAB1NP_006107.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
PP2C 69..334 CDD:395385 72/359 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 430..478
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144770
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.