DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12155 and madf-4

DIOPT Version :9

Sequence 1:NP_572403.1 Gene:CG12155 / 31682 FlyBaseID:FBgn0029957 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_505565.3 Gene:madf-4 / 179386 WormBaseID:WBGene00011575 Length:329 Species:Caenorhabditis elegans


Alignment Length:248 Identity:58/248 - (23%)
Similarity:91/248 - (36%) Gaps:80/248 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 DNAPTDDILTLINLVRQNPVLYNYKLQPNQRRRSDVLNG--------WQEVAQQIGNKYTVQEVR 70
            |....|..|.||:.|::||.:||         |.|.|:.        |:.::.:||......|:.
 Worm    12 DPLEDDFTLALIDSVQRNPCVYN---------RYDPLHKVTDYKHEIWKLISIEIGYDGQPVELE 67

  Fly    71 RKWKNLRDTFHQYRLR---TPKYIEGRLSKW-RYAKELDFLSKVYQPKLKSHRN--TQITYETSG 129
            ||||::||.:  .|||   ..|....:.:|| .|..::.||....:     |||  .|..|    
 Worm    68 RKWKHMRDKY--VRLRKQDKQKAPIKKTNKWYNYYHKMSFLDPYVE-----HRNRKRQKDY---- 121

  Fly   130 VAGAGGGIGGANSTTLPIGAMLHLKQHVDDDDDEVMD-----------------DDGQSDHDTAT 177
                      .||.|          ....|||...:|                 |.|.:...|.:
 Worm   122 ----------LNSNT----------PDFLDDDTAFLDGLSVKEMLKPESLLTSNDAGYNSPHTTS 166

  Fly   178 LSSHHGT--------SQITLVSDEAETFILTAYEEGVSDDTVSQHHHHHHHGH 222
            .||..|:        |....:.|:.:...| .|::.|::.|.::.:|...:.|
 Worm   167 SSSSSGSNNNGRFLDSPTIDIEDDKKNLAL-IYDKFVANQTENEKNHRFSNKH 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12155NP_572403.1 MADF 24..112 CDD:214738 29/99 (29%)
madf-4NP_505565.3 MADF 22..111 CDD:214738 29/99 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001895
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.