DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12155 and LOC110439798

DIOPT Version :9

Sequence 1:NP_572403.1 Gene:CG12155 / 31682 FlyBaseID:FBgn0029957 Length:555 Species:Drosophila melanogaster
Sequence 2:XP_021332041.1 Gene:LOC110439798 / 110439798 -ID:- Length:273 Species:Danio rerio


Alignment Length:194 Identity:47/194 - (24%)
Similarity:75/194 - (38%) Gaps:69/194 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 TLINLVRQNPVLYNYKLQPNQR---RRSDVLNGWQEVAQQIGNKYTVQEVRRKWKNLRDTFHQYR 84
            ||:..|.:.|:|:| :|:.:.|   ||..|   |::||..||  .:|.|.:|:||.:||.:.:.|
Zfish    31 TLLRAVYRIPLLHN-RLRTDYRSTERRERV---WRDVAASIG--LSVVECKRRWKTIRDRYIRER 89

  Fly    85 --LRTPKYIEG-RLSKWRYAKELDFLSKVYQPKLKSHRNTQITYETSGVAGAGGGIGGANSTTLP 146
              .:..|.:.| ||..|.:.:.|.||    ...::..|      ..||..|.             
Zfish    90 RLCKLKKDLGGRRLHYWPHRESLAFL----DAHIRKRR------RPSGAQGP------------- 131

  Fly   147 IGAMLHLKQHVDDDDDEVMDDDGQSDHDTATLSSHHGTSQITLVSDEAETFILTAYEEGVSDDT 210
                               :::.|.:|.:|.|.           .|:.|    ...||.|||.:
Zfish   132 -------------------EEEQQEEHSSAALQ-----------EDKEE----CVQEECVSDSS 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12155NP_572403.1 MADF 24..112 CDD:214738 31/93 (33%)
LOC110439798XP_021332041.1 MADF 32..120 CDD:214738 31/97 (32%)
BESS 233..267 CDD:308542
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.