DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NELF-B and aifm3

DIOPT Version :9

Sequence 1:NP_572402.1 Gene:NELF-B / 31681 FlyBaseID:FBgn0027553 Length:594 Species:Drosophila melanogaster
Sequence 2:XP_012823655.1 Gene:aifm3 / 100493696 XenbaseID:XB-GENE-5763104 Length:618 Species:Xenopus tropicalis


Alignment Length:257 Identity:55/257 - (21%)
Similarity:91/257 - (35%) Gaps:72/257 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 TQHIDDKYLKILVRDRELYADTDTEV--KRQI----WRDNQSLFGD----EVSPLLSQYIREKEH 183
            ::.:|.:..:|.:|.:|.:...|.||  :.|:    .::...||.|    |.:.||.......:.
 Frog   239 SKSMDSQAEQIFLRSKEFFHTYDIEVLTESQVVGVDTKNKMVLFKDGFRMEYNKLLIATGNTPKT 303

  Fly   184 ILFDHTNLNNLFFHPTP----KVRRQGEVVQKLANMIGTSVKLYDMVLQFLRTLFLRTRNVHYCT 244
            :......|:|:|...||    ||.|...  .|.|.::|.|              ||......|..
 Frog   304 LKCKGKELDNVFTIRTPEDANKVVRLAS--SKNAVIVGAS--------------FLGMEVAAYLC 352

  Fly   245 LRAELLMALHDLEVQEIISIDPCHKFTWCLDACIREK------------------NVDIKRSREL 291
            .:|      |.:.|.|:.:| |..||       :.||                  ..::...||.
 Frog   353 EKA------HSVSVVELENI-PFKKF-------LGEKVGLAIMKMFENNRVKFYMQTEVSELREQ 403

  Fly   292 QGFLDNIKRGQEQVLGDLSMTLCDPYAINFLATSAIKILHHLINNEGMPRDNQILILLLRML 353
            :|.|      :|.||....:...|...|...|:.....|    ...|:..|::..||:.:|:
 Frog   404 EGKL------KEVVLKSGKVLRADVCVIGIGASPTTGFL----KQSGVALDSRGYILVNKMM 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NELF-BNP_572402.1 COBRA1 116..588 CDD:283791 55/257 (21%)
aifm3XP_012823655.1 Rieske_AIFL_N 70..164 CDD:239560
Pyr_redox_2 195..493 CDD:400379 55/257 (21%)
Reductase_C 512..>582 CDD:405449
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165164486
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.