DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hira and WDR5b

DIOPT Version :9

Sequence 1:NP_572401.2 Gene:Hira / 31680 FlyBaseID:FBgn0022786 Length:1047 Species:Drosophila melanogaster
Sequence 2:NP_192182.1 Gene:WDR5b / 828189 AraportID:AT4G02730 Length:333 Species:Arabidopsis thaliana


Alignment Length:394 Identity:85/394 - (21%)
Similarity:144/394 - (36%) Gaps:116/394 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 TGGQGSDCGRVVIWNLLPVLSDKAEFDADVP-----KMLCQMDQHLACVNCVRWSQNGQNLASGS 89
            :||.|:..| |...|    .:..|....:||     :.|..::.|.|.::||::|.:|..|||.|
plant     3 SGGNGTSNG-VANAN----STGNAGTSGNVPIYKPYRHLKTLEGHTAAISCVKFSNDGNLLASAS 62

  Fly    90 DDKLIMIWRKSAGSSGVFGTGGMQKNHESWKCFYTLRGHDGDVLDLAWSPNDVYLASCSIDNTVI 154
            .||.:::|..:                 ::...:...||...:.|||||.:..|..|.|.|.|:.
plant    63 VDKTMILWSAT-----------------NYSLIHRYEGHSSGISDLAWSSDSHYTCSASDDCTLR 110

  Fly   155 IWDAQAFPHSVATLKGHTGLVKGVSWDPLGRFLASQSDDRSIKIWNTMNWSLSHTITEPFEECGG 219
            ||||::....:..|:|||..|..|:::|....:.|.|.|.:|:||..........|         
plant   111 IWDARSPYECLKVLRGHTNFVFCVNFNPPSNLIVSGSFDETIRIWEVKTGKCVRMI--------- 166

  Fly   220 TTHILRLS---WSPDGQYLVSA--------------------------------HAMNGG----- 244
            ..|.:.:|   ::.||..:|||                                .:.||.     
plant   167 KAHSMPISSVHFNRDGSLIVSASHDGSCKIWDAKEGTCLKTLIDDKSPAVSFAKFSPNGKFILVA 231

  Fly   245 --GPTAQIIEREGWKCDKDFVGHRKAVTCVRFHNSILSRQENDGSPSKPLQYCCLAVGSRDRSLS 307
              ..|.::......|..|.:.||...|.|:....|:.:.:             .:..||.|..:.
plant   232 TLDSTLKLSNYATGKFLKVYTGHTNKVFCITSAFSVTNGK-------------YIVSGSEDNCVY 283

  Fly   308 VWMTALQRPMVVIHELFNASILDLTWGPQECLLMACSVDGSIAC------LKFTEEELGKAISEE 366
            :|            :|...:||....|..:.::       |::|      :..:...|.|.|...
plant   284 LW------------DLQARNILQRLEGHTDAVI-------SVSCHPVQNEISSSGNHLDKTIRIW 329

  Fly   367 EQNA 370
            :|:|
plant   330 KQDA 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HiraNP_572401.2 WD40 <12..370 CDD:225201 84/392 (21%)
WD40 14..349 CDD:238121 78/365 (21%)
WD40 repeat 16..68 CDD:293791 10/42 (24%)
WD40 repeat 74..127 CDD:293791 11/52 (21%)
WD40 repeat 132..169 CDD:293791 14/36 (39%)
WD40 repeat 176..211 CDD:293791 8/34 (24%)
WD40 repeat 223..263 CDD:293791 11/81 (14%)
WD40 repeat 275..322 CDD:293791 5/46 (11%)
WD40 repeat 328..350 CDD:293791 4/21 (19%)
HIRA_B 423..442 CDD:286531
Hira 629..820 CDD:284895
WDR5bNP_192182.1 WD40 26..>330 CDD:225201 76/361 (21%)
WD40 35..330 CDD:238121 74/352 (21%)
WD40 repeat 46..83 CDD:293791 11/53 (21%)
WD40 repeat 89..126 CDD:293791 15/36 (42%)
WD40 repeat 131..167 CDD:293791 10/44 (23%)
WD40 repeat 174..209 CDD:293791 6/34 (18%)
WD40 repeat 216..252 CDD:293791 5/35 (14%)
WD40 repeat 260..297 CDD:293791 9/61 (15%)
WD40 repeat 303..329 CDD:293791 5/32 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.