DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hira and AT3G56900

DIOPT Version :9

Sequence 1:NP_572401.2 Gene:Hira / 31680 FlyBaseID:FBgn0022786 Length:1047 Species:Drosophila melanogaster
Sequence 2:NP_191249.2 Gene:AT3G56900 / 824857 AraportID:AT3G56900 Length:447 Species:Arabidopsis thaliana


Alignment Length:232 Identity:57/232 - (24%)
Similarity:90/232 - (38%) Gaps:48/232 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 GRVVIW------NLLPVLSDKAEFDADVPK-----------MLCQMDQHLACVNCVRWSQNGQNL 85
            |.:.||      |:..|.|..:.....:.:           :.||.|:.::.::   ||..|:.|
plant   166 GGICIWAASYPGNMALVRSGGSALRGSLSRGSGTRWILVDFLRCQNDEQISALS---WSPCGRYL 227

  Fly    86 ASGS-DDKLIMIWRKSAGSSGVFGTGGMQKNHESWKCFYTLRGHDGDVLDLAWSPNDVYLASCSI 149
            ||.| |.....||..|.|:    ||              .:|...|.:..|.|||...|..:...
plant   228 ASASYDSSSFTIWDVSQGA----GT--------------PIRRGLGGISMLKWSPTGDYFFAARF 274

  Fly   150 DNTVIIWDAQAFPHSVATLKGHTGLVKGVSWDPLGRFLA---SQSDDRSIKIWNTMNWSL-SHTI 210
            |.|..:|:...:.....:|...:|.|.|..|||.|||:.   |:|.......:::...|| :|.:
plant   275 DGTFCLWETNTWTSEPWSLSSGSGSVTGAIWDPEGRFILISFSKSSTLGSVHFSSKPPSLDAHLL 339

  Fly   211 TEPFEECG---GTTHILRLSWSPDGQYLVSAHAMNGG 244
            .....|..   |...|.:::|...|:.|  |.:..||
plant   340 PVELPEIASLTGCEGIEKIAWDASGERL--AVSYKGG 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HiraNP_572401.2 WD40 <12..370 CDD:225201 57/232 (25%)
WD40 14..349 CDD:238121 57/232 (25%)
WD40 repeat 16..68 CDD:293791 8/46 (17%)
WD40 repeat 74..127 CDD:293791 14/53 (26%)
WD40 repeat 132..169 CDD:293791 8/36 (22%)
WD40 repeat 176..211 CDD:293791 12/38 (32%)
WD40 repeat 223..263 CDD:293791 7/22 (32%)
WD40 repeat 275..322 CDD:293791
WD40 repeat 328..350 CDD:293791
HIRA_B 423..442 CDD:286531
Hira 629..820 CDD:284895
AT3G56900NP_191249.2 WD40 83..>388 CDD:225201 57/232 (25%)
WD40 <105..282 CDD:295369 32/136 (24%)
WD40 repeat 105..141 CDD:293791
WD40 repeat 147..194 CDD:293791 6/27 (22%)
WD40 215..419 CDD:295369 48/183 (26%)
WD40 repeat 216..255 CDD:293791 15/59 (25%)
WD40 repeat 257..283 CDD:293791 8/25 (32%)
WD40 repeat 287..317 CDD:293791 10/29 (34%)
WD40 repeat 322..372 CDD:293791 10/51 (20%)
WD40 repeat 380..417 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.