DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hira and ARPC1B

DIOPT Version :9

Sequence 1:NP_572401.2 Gene:Hira / 31680 FlyBaseID:FBgn0022786 Length:1047 Species:Drosophila melanogaster
Sequence 2:NP_001323442.1 Gene:ARPC1B / 817687 AraportID:AT2G31300 Length:379 Species:Arabidopsis thaliana


Alignment Length:229 Identity:53/229 - (23%)
Similarity:78/229 - (34%) Gaps:81/229 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 AWSPNDVYLASCSIDNTVIIWDAQAFPH--SVATLKGHTGLVKGVSWDPLGRFLASQSDDRSIKI 198
            ||||:...:|.|..:..|.|:.:.:..|  .:..|:.|..:|.|:.|......:.:.|.||    
plant    17 AWSPDLSMVALCPNNTEVHIYKSLSQDHWERLHVLQKHDQIVSGIDWSSKSNKIVTVSHDR---- 77

  Fly   199 WNTMNWSLSHTITEPFEECGGTTHILRLS-------WSPDGQYLVSAHAMNGGGPTAQIIEREGW 256
             |:..|||......|      |..||||:       |||                          
plant    78 -NSYVWSLEGAEWVP------TLVILRLNRAALCVQWSP-------------------------- 109

  Fly   257 KCDKDFVGHRKAVTCVRFHNSILSRQENDGSPSKPLQYCCLAVGSRDRSLSVWMTALQRPMVVIH 321
            |.:|..||......|:.::     .|||:.                      |::.|.|..   |
plant   110 KENKFAVGSGAKTVCICYY-----EQENNW----------------------WVSKLIRKR---H 144

  Fly   322 ELFNASILDLTWGPQECLLMACSVDGSIACLKFT 355
            |   :|:..:.|.|...||...|.||.  |..|:
plant   145 E---SSVTSVAWHPNNVLLATTSTDGK--CRVFS 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HiraNP_572401.2 WD40 <12..370 CDD:225201 53/229 (23%)
WD40 14..349 CDD:238121 51/221 (23%)
WD40 repeat 16..68 CDD:293791
WD40 repeat 74..127 CDD:293791
WD40 repeat 132..169 CDD:293791 9/34 (26%)
WD40 repeat 176..211 CDD:293791 9/34 (26%)
WD40 repeat 223..263 CDD:293791 9/46 (20%)
WD40 repeat 275..322 CDD:293791 6/46 (13%)
WD40 repeat 328..350 CDD:293791 7/21 (33%)
HIRA_B 423..442 CDD:286531
Hira 629..820 CDD:284895
ARPC1BNP_001323442.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.