DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hira and fzr

DIOPT Version :9

Sequence 1:NP_572401.2 Gene:Hira / 31680 FlyBaseID:FBgn0022786 Length:1047 Species:Drosophila melanogaster
Sequence 2:NP_524852.2 Gene:fzr / 45922 FlyBaseID:FBgn0262699 Length:478 Species:Drosophila melanogaster


Alignment Length:287 Identity:73/287 - (25%)
Similarity:108/287 - (37%) Gaps:74/287 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GSDCGRVVIWNLLPVLSDKAEFDADVPKMLCQMDQHLACVNCVRWSQNGQNLASGSDDKLIMIWR 98
            |:..|.|.:|            |....|.:.:::.|.|.|..:.|  |...|:|||.|:.| |.|
  Fly   232 GTHHGYVTVW------------DVAANKQINKLNGHSARVGALAW--NSDILSSGSRDRWI-IQR 281

  Fly    99 KSAGSSGVFGTGGMQKNHESWKCFYTLRGHDGDVLDLAWSPNDVYLASCSIDNTVIIWDAQAFPH 163
            .:.       |..:|....       |.||..:|..|.|||::.||||...||.:.:|:    .|
  Fly   282 DTR-------TPQLQSERR-------LAGHRQEVCGLKWSPDNQYLASGGNDNRLYVWN----QH 328

  Fly   164 SVATLKG---HTGLVKGVSWDPLGRFLASQ---SDDRSIKIWNTMNWSLSHTITEPFEECGGTTH 222
            ||..::.   |...||.::|.|....|.:.   :.||.|:.|||:.       .:|.:.....:.
  Fly   329 SVNPVQSYTEHMAAVKAIAWSPHHHGLLASGGGTADRCIRFWNTLT-------GQPMQCVDTGSQ 386

  Fly   223 ILRLSWSPDGQYLVSAHAMNGGGPTAQIIEREGWKCDK-----DFVGHRKAVTCVRFHNSILSRQ 282
            :..|:||.....|||.|    |....||:.   ||...     ...||...|..:..        
  Fly   387 VCNLAWSKHSSELVSTH----GYSQNQILV---WKYPSLTQVAKLTGHSYRVLYLAL-------- 436

  Fly   283 ENDGSPSKPLQYCCLAVGSRDRSLSVW 309
            ..||.        .:..|:.|.:|..|
  Fly   437 SPDGE--------AIVTGAGDETLRFW 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HiraNP_572401.2 WD40 <12..370 CDD:225201 73/287 (25%)
WD40 14..349 CDD:238121 73/287 (25%)
WD40 repeat 16..68 CDD:293791 6/33 (18%)
WD40 repeat 74..127 CDD:293791 13/52 (25%)
WD40 repeat 132..169 CDD:293791 15/36 (42%)
WD40 repeat 176..211 CDD:293791 10/37 (27%)
WD40 repeat 223..263 CDD:293791 12/44 (27%)
WD40 repeat 275..322 CDD:293791 6/35 (17%)
WD40 repeat 328..350 CDD:293791
HIRA_B 423..442 CDD:286531
Hira 629..820 CDD:284895
fzrNP_524852.2 WD40 <174..469 CDD:225201 73/287 (25%)
WD40 178..456 CDD:238121 73/287 (25%)
WD40 repeat 217..254 CDD:293791 6/33 (18%)
WD40 repeat 260..296 CDD:293791 13/52 (25%)
WD40 repeat 301..337 CDD:293791 15/39 (38%)
WD40 repeat 344..382 CDD:293791 11/44 (25%)
WD40 repeat 387..425 CDD:293791 12/44 (27%)
WD40 repeat 431..457 CDD:293791 7/41 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.