DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hira and POC1B

DIOPT Version :9

Sequence 1:NP_572401.2 Gene:Hira / 31680 FlyBaseID:FBgn0022786 Length:1047 Species:Drosophila melanogaster
Sequence 2:NP_758440.1 Gene:POC1B / 282809 HGNCID:30836 Length:478 Species:Homo sapiens


Alignment Length:513 Identity:112/513 - (21%)
Similarity:185/513 - (36%) Gaps:141/513 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 HLACVNCVRWSQNGQNLASGSDDKLIMIWRKSAGSSGVFGTGGMQKNHESWKCFYTLRGHDGDVL 133
            |.|.:..:..|.||:.||:.|.|..:|:|                 |.:.....|...||...|.
Human    17 HKAAITSLDLSPNGKQLATASWDTFLMLW-----------------NFKPHARAYRYVGHKDVVT 64

  Fly   134 DLAWSPNDVYLASCSIDNTVIIW--DAQAFPHSVATLKGHTGLVKGVSWDPLGRFLASQSDDRSI 196
            .:.:||:...|||.|.|.||.:|  |.:.   ..:..|.||..|:.|.:...|:|||:.|:|:||
Human    65 SVQFSPHGNLLASASRDRTVRLWIPDKRG---KFSEFKAHTAPVRSVDFSADGQFLATASEDKSI 126

  Fly   197 KIWNTMNWSLSHTITEPFEECGGTTHILRLS-WSPDGQYLVSAHAMNGGGPTAQIIEREGWKCDK 260
            |:|:.......:::..       .||.:|.: :||||:.:||.    ....|.:|.:....:|..
Human   127 KVWSMYRQRFLYSLYR-------HTHWVRCAKFSPDGRLIVSC----SEDKTIKIWDTTNKQCVN 180

  Fly   261 DFVGHRKAVTCVRFHNSILSRQENDGSPSKPLQYCCLAVGSRDRSLSVWMTALQRPMVVIHELFN 325
            :|      ...|.|.|.:      |.:||.    .|:|....|:::.||...:.: ::..:::.:
Human   181 NF------SDSVGFANFV------DFNPSG----TCIASAGSDQTVKVWDVRVNK-LLQHYQVHS 228

  Fly   326 ASILDLTWGPQECLLMACSVDGSIACLKFTEEELGKAISEEEQNAIIRKMYGKNYVNGLGKSAPV 390
            ..:..:::.|....|:..|.||::..|...|..|...:.                    |.:.||
Human   229 GGVNCISFHPSGNYLITASSDGTLKILDLLEGRLIYTLQ--------------------GHTGPV 273

  Fly   391 L--------EHPQRLLLPQGDKPTKFPL--SNNNEANQRPISKQTETRTKDGKRRITPMFIPLHE 445
            .        |     |...|...|:..|  :|.:|.:.:.::|:...|              ||.
Human   274 FTVSFSKGGE-----LFASGGADTQVLLWRTNFDELHCKGLTKRNLKR--------------LHF 319

  Fly   446 DGPTSLSMNIVSSSGSSTTALTSCSAAIGTLPAAAPTESAATPLMPLEPLVSKIDLGRLDSRLKT 510
            |.|..|                     :...|............:.:.|.:..|||     ::.|
Human   320 DSPPHL---------------------LDIYPRTPHPHEEKVETVEINPKLEVIDL-----QIST 358

  Fly   511 QPASQRRQSLPFDPGQSNELL-RTPRLEEHQSSTC---------SPSNLNVTATGKSE 558
            .|.   ...|.||...:.|.. ||  |.:.....|         ||..|..|...|:|
Human   359 PPV---MDILSFDSTTTTETSGRT--LPDKGEEACGYFLNPSLMSPECLPTTTKKKTE 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HiraNP_572401.2 WD40 <12..370 CDD:225201 74/303 (24%)
WD40 14..349 CDD:238121 71/282 (25%)
WD40 repeat 16..68 CDD:293791
WD40 repeat 74..127 CDD:293791 11/52 (21%)
WD40 repeat 132..169 CDD:293791 12/38 (32%)
WD40 repeat 176..211 CDD:293791 11/34 (32%)
WD40 repeat 223..263 CDD:293791 10/40 (25%)
WD40 repeat 275..322 CDD:293791 9/46 (20%)
WD40 repeat 328..350 CDD:293791 5/21 (24%)
HIRA_B 423..442 CDD:286531 2/18 (11%)
Hira 629..820 CDD:284895
POC1BNP_758440.1 WD40 10..298 CDD:238121 82/353 (23%)
WD 1 16..55 12/54 (22%)
WD40 repeat 21..58 CDD:293791 11/53 (21%)
WD 2 58..99 14/43 (33%)
WD40 repeat 63..100 CDD:293791 12/39 (31%)
WD 3 101..139 14/37 (38%)
WD40 repeat 106..142 CDD:293791 11/35 (31%)
WD 4 142..181 12/49 (24%)
WD40 repeat 147..182 CDD:293791 10/38 (26%)
WD 5 183..223 11/50 (22%)
WD40 repeat 190..225 CDD:293791 9/45 (20%)
WD 6 226..265 8/38 (21%)
WD40 repeat 231..267 CDD:293791 8/35 (23%)
WD 7 268..307 10/43 (23%)
WD40 repeat 273..299 CDD:293791 6/30 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.