| Sequence 1: | NP_572401.2 | Gene: | Hira / 31680 | FlyBaseID: | FBgn0022786 | Length: | 1047 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_592966.1 | Gene: | SPAC227.12 / 2541477 | PomBaseID: | SPAC227.12 | Length: | 462 | Species: | Schizosaccharomyces pombe |
| Alignment Length: | 261 | Identity: | 69/261 - (26%) |
|---|---|---|---|
| Similarity: | 103/261 - (39%) | Gaps: | 72/261 - (27%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 13 DKQIFSVDIHKDCTKFATGGQGSDCGRVVIWN--------LLPVLSDKAE----------FDADV 59
Fly 60 PKM---------------------LCQMDQHLACVNCVRWSQNGQNLASGSDDKLIMIWRKSAG- 102
Fly 103 --------SSGVF-----------GTGGMQKNHESW-----KCFYTLRGHDGDVLDLAWSPNDVY 143
Fly 144 LASCSIDNTVIIWDAQAFPHSVA-TLKGHTGLVKGVSWDPLG--RFLASQSDDRSIKIWNTMNWS 205
Fly 206 L 206 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Hira | NP_572401.2 | WD40 | <12..370 | CDD:225201 | 69/261 (26%) |
| WD40 | 14..349 | CDD:238121 | 69/260 (27%) | ||
| WD40 repeat | 16..68 | CDD:293791 | 16/90 (18%) | ||
| WD40 repeat | 74..127 | CDD:293791 | 16/77 (21%) | ||
| WD40 repeat | 132..169 | CDD:293791 | 17/37 (46%) | ||
| WD40 repeat | 176..211 | CDD:293791 | 12/33 (36%) | ||
| WD40 repeat | 223..263 | CDD:293791 | |||
| WD40 repeat | 275..322 | CDD:293791 | |||
| WD40 repeat | 328..350 | CDD:293791 | |||
| HIRA_B | 423..442 | CDD:286531 | |||
| Hira | 629..820 | CDD:284895 | |||
| SPAC227.12 | NP_592966.1 | SFM | 48..92 | CDD:128776 | |
| WD40 | 174..460 | CDD:238121 | 69/259 (27%) | ||
| WD40 | <178..460 | CDD:225201 | 68/255 (27%) | ||
| WD40 repeat | 178..212 | CDD:293791 | 10/36 (28%) | ||
| WD40 repeat | 218..263 | CDD:293791 | 4/44 (9%) | ||
| WD40 repeat | 268..304 | CDD:293791 | 9/35 (26%) | ||
| WD40 repeat | 311..346 | CDD:293791 | 5/34 (15%) | ||
| WD40 repeat | 352..384 | CDD:293791 | 15/33 (45%) | ||
| WD40 repeat | 394..432 | CDD:293791 | 13/34 (38%) | ||
| WD40 repeat | 438..460 | CDD:293791 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||