DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hira and lis-1

DIOPT Version :9

Sequence 1:NP_572401.2 Gene:Hira / 31680 FlyBaseID:FBgn0022786 Length:1047 Species:Drosophila melanogaster
Sequence 2:NP_499755.1 Gene:lis-1 / 176758 WormBaseID:WBGene00003047 Length:404 Species:Caenorhabditis elegans


Alignment Length:327 Identity:81/327 - (24%)
Similarity:119/327 - (36%) Gaps:92/327 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RVV---IWNLLPVLSDKAE---FDADVPKMLCQMDQHLACVNCVRWSQNGQNLASGSDDKLIMIW 97
            ||:   :|.::...|:.|.   :|.:..::...:..|...||.:.....|:.|.|.|.|..|.:|
 Worm   111 RVIFHPLWTIMASCSEDATIKVWDYETGQLERTLKGHTDAVNDIAIDAAGKQLVSCSSDLSIKLW 175

  Fly    98 ---------------RKSAGSSGVFGTG----GMQKNH--ESWK-----CFYTLRGHDGDVLDLA 136
                           ..:..|.....||    ...::|  :.|.     |.||.|||:..|..:.
 Worm   176 DFGQTYDCLKSLKGHEHTVSSVTFLPTGDFVLSASRDHTIKQWDISTGYCVYTFRGHNDWVRMIR 240

  Fly   137 WSPNDVYLASCSIDNTVIIWDAQAFPHSVAT------LKGHTGLVKGVSWDP-------LGR--- 185
            .|.:....||.|:|.||.:|       |.||      |:.|...|:.|.|.|       .|:   
 Worm   241 ISNDGTLFASASLDQTVTVW-------SFATKSAKLVLRDHEHAVECVEWAPDTAYTNVTGQQPE 298

  Fly   186 -----FLASQSDDRSIKIWNTMNWSLSHTITEPFEECGGTTH---ILRLSWSPDGQYLVSAHAMN 242
                 .|.|.|.|||||.||.....:..|:         ..|   :..|::.|.|:||:|.    
 Worm   299 GNSTHILFSGSRDRSIKAWNINTGDVLFTL---------LAHENWVRGLAFHPKGKYLISV---- 350

  Fly   243 GGGPTAQIIEREGWKCDKDFVGHRKAVTCVRFHNSILSRQENDGSPSKPLQYCCLAVGSRDRSLS 307
            ....|.::.|....:|.|....|...|:.|.||.:         ||       .:..||.|.|..
 Worm   351 ADDKTLRVWELSAQRCMKAIEAHEHFVSTVAFHQT---------SP-------FVITGSVDMSCK 399

  Fly   308 VW 309
            ||
 Worm   400 VW 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HiraNP_572401.2 WD40 <12..370 CDD:225201 81/327 (25%)
WD40 14..349 CDD:238121 81/327 (25%)
WD40 repeat 16..68 CDD:293791 6/34 (18%)
WD40 repeat 74..127 CDD:293791 16/78 (21%)
WD40 repeat 132..169 CDD:293791 12/42 (29%)
WD40 repeat 176..211 CDD:293791 15/49 (31%)
WD40 repeat 223..263 CDD:293791 10/39 (26%)
WD40 repeat 275..322 CDD:293791 9/35 (26%)
WD40 repeat 328..350 CDD:293791
HIRA_B 423..442 CDD:286531
Hira 629..820 CDD:284895
lis-1NP_499755.1 LisH 7..39 CDD:128913
WD40 98..402 CDD:238121 81/327 (25%)
WD40 <100..404 CDD:225201 81/327 (25%)
WD40 repeat 109..146 CDD:293791 6/34 (18%)
WD40 repeat 152..189 CDD:293791 8/36 (22%)
WD40 repeat 194..230 CDD:293791 8/35 (23%)
WD40 repeat 237..272 CDD:293791 11/41 (27%)
WD40 repeat 278..329 CDD:293791 16/59 (27%)
WD40 repeat 335..371 CDD:293791 10/39 (26%)
WD40 repeat 377..401 CDD:293791 10/39 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.