DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hira and ARPC1A

DIOPT Version :9

Sequence 1:NP_572401.2 Gene:Hira / 31680 FlyBaseID:FBgn0022786 Length:1047 Species:Drosophila melanogaster
Sequence 2:NP_006400.2 Gene:ARPC1A / 10552 HGNCID:703 Length:370 Species:Homo sapiens


Alignment Length:170 Identity:37/170 - (21%)
Similarity:71/170 - (41%) Gaps:26/170 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 VNCVRWSQNGQNLASGSDDKLIMIWRKSAGSSGVFGTGGMQKNHESWKCFYTLRGHDGDVLDLAW 137
            :.|..|:::...:|...::..:.|::|: ||..|       |.||       |:.|:|.:..:.|
Human    11 ITCHAWNRDRTQIALSPNNHEVHIYKKN-GSQWV-------KAHE-------LKEHNGHITGIDW 60

  Fly   138 SPNDVYLASCSIDNTVIIWDAQ--AFPHSVATLKGHTGLVKGVSWDPLGRFLASQSDDRSIKIW- 199
            :|....:.:|..|....:|..:  .:..::..|:.:.. ...|.|.||....|..|..|.|.:. 
Human    61 APKSDRIVTCGADRNAYVWSQKDGVWKPTLVILRINRA-ATFVKWSPLENKFAVGSGARLISVCY 124

  Fly   200 --NTMNWSLSHTITEPFEECGGTTHILRLSWSPDGQYLVS 237
              :..:|.:|..|.:|..     :.:|.|.|.|:...|.:
Human   125 FESENDWWVSKHIKKPIR-----STVLSLDWHPNNVLLAA 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HiraNP_572401.2 WD40 <12..370 CDD:225201 37/170 (22%)
WD40 14..349 CDD:238121 37/170 (22%)
WD40 repeat 16..68 CDD:293791
WD40 repeat 74..127 CDD:293791 12/52 (23%)
WD40 repeat 132..169 CDD:293791 5/38 (13%)
WD40 repeat 176..211 CDD:293791 10/37 (27%)
WD40 repeat 223..263 CDD:293791 5/15 (33%)
WD40 repeat 275..322 CDD:293791
WD40 repeat 328..350 CDD:293791
HIRA_B 423..442 CDD:286531
Hira 629..820 CDD:284895
ARPC1ANP_006400.2 WD 1 6..45 8/41 (20%)
WD40 <9..80 CDD:421866 18/83 (22%)
WD40 repeat 11..50 CDD:293791 12/53 (23%)
WD40 46..>288 CDD:421866 28/127 (22%)
WD 2 50..89 7/38 (18%)
WD40 repeat 56..93 CDD:293791 5/36 (14%)
WD40 repeat 98..138 CDD:293791 10/40 (25%)
WD 3 140..179 6/25 (24%)
WD40 repeat 146..199 CDD:293791 5/14 (36%)
WD 4 202..241
WD40 repeat 207..243 CDD:293791
WD 5 244..284
WD40 repeat 249..287 CDD:293791
WD 6 322..365
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.