DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHES-1-like and FKH1

DIOPT Version :9

Sequence 1:NP_001259311.1 Gene:CHES-1-like / 31678 FlyBaseID:FBgn0029504 Length:1268 Species:Drosophila melanogaster
Sequence 2:NP_012135.1 Gene:FKH1 / 854675 SGDID:S000001393 Length:484 Species:Saccharomyces cerevisiae


Alignment Length:209 Identity:61/209 - (29%)
Similarity:94/209 - (44%) Gaps:41/209 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   611 GGGGGGGANLRSPNSYASYDNEDSLKEFDLVVSSRL----HTSTPQYSVSKNGANGYGNGN---- 667
            |..|.....||:....::|..|..|:|     .:||    |..||..|.|.....|..:|:    
Yeast   194 GTNGNNNPLLRNIIEGSTYLREQRLQE-----EARLQQLDHLHTPLSSSSDVNPIGDPHGDTIMM 253

  Fly   668 --------------------SNVNGSGAGSNTPQKQKHPNNVPYDPLVHTNN--KPPYSFSSLIF 710
                                |:.|.:....|.|    |..| |.|..:..|.  |||.|::|:|.
Yeast   254 EEDEEDENYTRGGIRPNTYTSSSNNAVTNGNVP----HIEN-PSDLSLDENRYIKPPQSYASMIT 313

  Fly   711 MAIEGSNEKALPVKEIYAWIVQHFPYFKTAPNGWKNSVRHNLSLNKSFVKVEK-APNMGKGSLWR 774
            .||..:.|.::.:.:||.:|..::.:::.:...|:|||||||||||:|.||.| |...|||..|:
Yeast   314 QAILSTPEGSISLADIYKFISDNYAFYRFSQMAWQNSVRHNLSLNKAFEKVPKRAGQQGKGMNWK 378

  Fly   775 VEPQQRQNLIQALN 788
            :..:.|::.:...|
Yeast   379 ISDEVRRDFLNKWN 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHES-1-likeNP_001259311.1 Forkhead 700..785 CDD:278670 34/85 (40%)
FKH1NP_012135.1 COG5025 1..484 CDD:227358 61/209 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.