DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHES-1-like and Foxl1

DIOPT Version :9

Sequence 1:NP_001259311.1 Gene:CHES-1-like / 31678 FlyBaseID:FBgn0029504 Length:1268 Species:Drosophila melanogaster
Sequence 2:XP_006255788.1 Gene:Foxl1 / 687553 RGDID:1584212 Length:341 Species:Rattus norvegicus


Alignment Length:294 Identity:80/294 - (27%)
Similarity:117/294 - (39%) Gaps:85/294 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   695 VHTNNKPPYSFSSLIFMAIEGSNEKALPVKEIYAWIVQHFPYFKTAPNGWKNSVRHNLSLNKSFV 759
            |....|||||:.:||.|||:.:.|:.:.:..||.:|:..||::.....||:||:|||||||:.||
  Rat    44 VEPPQKPPYSYIALIAMAIQDAPEQRVTLNGIYQFIMDRFPFYHDNRQGWQNSIRHNLSLNECFV 108

  Fly   760 KVEKAPNM-GKGSLWRVEP-----------QQRQNLIQALNRSPFFPNSAV---------DKISP 803
            ||.:.... ||||.|.::|           ::|:...:....||....:.|         |..||
  Rat   109 KVPREKGRPGKGSYWTLDPRCLDMFENGNYRRRKRKPKPAAGSPEAKRTRVEPRESEVGCDVGSP 173

  Fly   804 SL------------KSP-SGGSAYDSL------------------DGGGSGSVSSAQPV------ 831
            :|            :|| :||:|..:|                  |.|...|....:||      
  Rat   174 NLATARPMHEPDRSQSPAAGGTARSALLPWPGPELRDPDADRTIQDAGAVASGQLERPVHYPVHH 238

  Fly   832 AGGAGVPAAAAVALSTPTKSNGL--ALANGASQATNAARP--HSPNGGGSGSHAR---------- 882
            .|.:..||.:.....:.:||..:  .||.....|:.|..|  ..|..|..||...          
  Rat   239 LGSSLRPAPSGSPKGSKSKSFSIDSILAVRPKPASGAEAPGISKPLPGALGSSLLTASSGLPPPF 303

  Fly   883 -----FDPYL--------FPNLSKAFRNIREDTV 903
                 |||::        .|.||.....:.|.||
  Rat   304 NASLVFDPHVQGGFSQLGIPFLSYFPLQVPEATV 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHES-1-likeNP_001259311.1 Forkhead 700..785 CDD:278670 38/96 (40%)
Foxl1XP_006255788.1 FH 49..137 CDD:214627 37/87 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.