DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHES-1-like and FOXD4L5

DIOPT Version :9

Sequence 1:NP_001259311.1 Gene:CHES-1-like / 31678 FlyBaseID:FBgn0029504 Length:1268 Species:Drosophila melanogaster
Sequence 2:NP_001119806.1 Gene:FOXD4L5 / 653427 HGNCID:18522 Length:416 Species:Homo sapiens


Alignment Length:263 Identity:74/263 - (28%)
Similarity:105/263 - (39%) Gaps:46/263 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   664 GNGNSNVNGSGAGSNTPQKQKHPNNVPYDPLVHTNNKPPYSFSSLIFMAIEGSNEKALPVKEIYA 728
            |.|.|:.:..|.....|.:....:.....|.     |||||:.:||.|||..:..|.|.:..|.|
Human    77 GGGPSDPSEFGTKFRAPPRSAAASEDARQPA-----KPPYSYIALITMAILQNPHKRLTLSGICA 136

  Fly   729 WIVQHFPYFKTAPNGWKNSVRHNLSLNKSFVKVEKAP-NMGKGSLWRVEPQ-------------- 778
            :|...|||::.....|:||:|||||||..|||:.:.| :.|||:.|.::|.              
Human   137 FISGRFPYYRRKFPAWQNSIRHNLSLNDCFVKIPREPGHPGKGNYWSLDPASQDMFDNGSFLRRR 201

  Fly   779 ---QRQNLIQALNRSPFFPNSAVDKISPSLKSPSGGSAYDSLDGGGSGSVSSAQPVAGG--AGVP 838
               :|..|....:....||..|.   ..:|.:|..|...        |:.:..|||.|.  ...|
Human   202 KRFKRHQLTPGAHLPHPFPLPAA---HAALHNPHPGPLL--------GAPAPPQPVPGAYPNTAP 255

  Fly   839 AAAAVALSTPTKSNGLALANGASQATNAARPHSPNGGGSGSHARF---DPYLFPNL---SKAFRN 897
            .....||..|.....|.|    |....|..|....|....:.|.|   .|:|..:|   ::.:|.
Human   256 GRCPYALLHPHPLRYLLL----SAPVYAGAPKKAEGADLATPAPFPCCSPHLVLSLGRRARVWRR 316

  Fly   898 IRE 900
            .||
Human   317 HRE 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHES-1-likeNP_001259311.1 Forkhead 700..785 CDD:278670 39/102 (38%)
FOXD4L5NP_001119806.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 70..105 5/27 (19%)
Forkhead 108..194 CDD:278670 37/85 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.