DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHES-1-like and Foxq1

DIOPT Version :9

Sequence 1:NP_001259311.1 Gene:CHES-1-like / 31678 FlyBaseID:FBgn0029504 Length:1268 Species:Drosophila melanogaster
Sequence 2:NP_074049.2 Gene:Foxq1 / 64826 RGDID:621572 Length:400 Species:Rattus norvegicus


Alignment Length:327 Identity:90/327 - (27%)
Similarity:127/327 - (38%) Gaps:75/327 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   589 TPTSQVHNGSLGGGGGGGGGSGGGGGG-----GGANLRSPNSYASYDNEDSLKEFDLVVSSRLHT 648
            :|.|...:.|||..|.....|...|.|     ||...|:.:..||..::..:.:           
  Rat    30 SPLSAAGDDSLGSDGDCAANSPAAGRGAVDLEGGGGERNSSGGASTQDDPEVTD----------- 83

  Fly   649 STPQYSVSKNGANGYGNGNSNVNGSGAGSNTPQKQKHPNNVPYDPLVHTNNKPPYSFSSLIFMAI 713
                  .|:..|:..|....:| |.|.|:.:....:.|             |||||:.:||.|||
  Rat    84 ------GSRTQASPVGPCAGSV-GGGEGARSKPYTRRP-------------KPPYSYIALIAMAI 128

  Fly   714 EGSNEKALPVKEIYAWIVQHFPYFKTAPNGWKNSVRHNLSLNKSFVKVEKAPN--MGKGSLWRVE 776
            ..|....|.:.||..:::..||:|:.:..||:||||||||||..||||.:.|:  .||.:.|.:.
  Rat   129 RDSAGGRLTLAEINEYLMGKFPFFRGSYTGWRNSVRHNLSLNDCFVKVLRDPSRPWGKDNYWMLN 193

  Fly   777 PQQRQNLIQALNRSPFFPNSAVDKISPSLKSPSGGSAYDSLDGGGSGSVSSAQPVAGGAGVPAAA 841
            |.........:.|......|....:|.|...|                 ..|.|  |.||.|..|
  Rat   194 PNSEYTFADGVFRRRRKRLSHRTTVSASGLRP-----------------EEAPP--GPAGTPQPA 239

  Fly   842 AVALSTPTKSNGLALANGASQATNAARPHSPNGGGSGSHARFDPYLFPNLSKAFRNIREDTVGQP 906
            ..|.|:|...:......|:|.|:..          |.|.|     :...|||.||:.|:   |.|
  Rat   240 PTAGSSPIARSPARQEEGSSPASKF----------SSSFA-----IDSILSKPFRSRRD---GDP 286

  Fly   907 ML 908
            .|
  Rat   287 AL 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHES-1-likeNP_001259311.1 Forkhead 700..785 CDD:278670 38/86 (44%)
Foxq1NP_074049.2 FH 115..193 CDD:238016 37/77 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.