DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHES-1-like and foxg1c

DIOPT Version :9

Sequence 1:NP_001259311.1 Gene:CHES-1-like / 31678 FlyBaseID:FBgn0029504 Length:1268 Species:Drosophila melanogaster
Sequence 2:NP_001038680.1 Gene:foxg1c / 571323 ZFINID:ZDB-GENE-050419-26 Length:379 Species:Danio rerio


Alignment Length:183 Identity:57/183 - (31%)
Similarity:85/183 - (46%) Gaps:47/183 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   676 GSNTPQKQKHPNNVPYDPLVHTNNKPPYSFSSLIFMAIEGSNEKALPVKEIYAWIVQHFPYFKTA 740
            |::.|:|:..|            :|||:|:::||.|||..|.|:.|.:..||.:|:.:|||::..
Zfish    78 GTDVPEKKSKP------------DKPPFSYNALIMMAIRQSPERRLTLNGIYEFIMGNFPYYREN 130

  Fly   741 PNGWKNSVRHNLSLNKSFVKVEK-APNMGKGSLWRVEPQQRQNLIQALNRSPFFPNSAVDKISPS 804
            ..||:||:||||||||.||||.: ..:.|||:.|.::|                           
Zfish   131 RQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDP--------------------------- 168

  Fly   805 LKSPSGGSAYDSLDGGGSGSVSSAQPVAGGAGVPAAAAVALSTPTKSNGLALA 857
                   |:.|...||.:|.:......|..|.:.......||:...|.|||.|
Zfish   169 -------SSDDVFIGGTTGKLRRRSTAASRAKLAMKRGARLSSTAASAGLAFA 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHES-1-likeNP_001259311.1 Forkhead 700..785 CDD:278670 39/85 (46%)
foxg1cNP_001038680.1 FH 90..178 CDD:214627 42/121 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.