DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHES-1-like and foxn2

DIOPT Version :9

Sequence 1:NP_001259311.1 Gene:CHES-1-like / 31678 FlyBaseID:FBgn0029504 Length:1268 Species:Drosophila melanogaster
Sequence 2:NP_001017017.1 Gene:foxn2 / 549771 XenbaseID:XB-GENE-952918 Length:334 Species:Xenopus tropicalis


Alignment Length:290 Identity:102/290 - (35%)
Similarity:139/290 - (47%) Gaps:76/290 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   646 LHTSTPQYSVSKNGANGYGNGNS--NVNG--SGAGSNTPQKQKHPNNVPYDPLVHTNNKPPYSFS 706
            ||.||...:....|:.|...|:.  ::.|  |.:|..||:|            :..::|||||||
 Frog    62 LHESTNLLNNFSLGSEGVPTGSPLYDIEGDLSPSGCQTPEK------------LSASSKPPYSFS 114

  Fly   707 SLIFMAIEGSNEKALPVKEIYAWIVQHFPYFKTAPNGWKNSVRHNLSLNKSFVKVEKAPNM--GK 769
            .||:||||.|..|.||||:||:||:..||||.|||.||||||||||||||.|.|||::...  ||
 Frog   115 LLIYMAIEHSPNKCLPVKDIYSWILDRFPYFATAPTGWKNSVRHNLSLNKYFQKVERSHGKVNGK 179

  Fly   770 GSLWRVEPQQRQNLIQALNRSPFFPNSAVDKISPSLKSPSGGSAYDSLDGGGSGSVSSAQPVAGG 834
            ||||.|:|:.:.:|||||.:.||  :||:...:|. .||:..|:..|:     .|:||.:.|.. 
 Frog   180 GSLWCVDPEYKPSLIQALKKQPF--SSALALYTPP-TSPTSVSSRSSV-----SSLSSVEEVYE- 235

  Fly   835 AGVPAAAAVALSTPTKSNGLALANGASQATNAARPHSPNGGGSGSHARFDPYLFPNLSKAFRNIR 899
                       ..|..|                  .:.:.|..|.|:..|..:         :..
 Frog   236 -----------FIPKNS------------------RAGSDGSEGFHSEDDTDI---------DYE 262

  Fly   900 EDTVG------QPMLQDALDDELSGDYHNN 923
            ||.:|      ||.:..:     |.|.|.|
 Frog   263 EDMLGDSGYVSQPCINPS-----SNDLHGN 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHES-1-likeNP_001259311.1 Forkhead 700..785 CDD:278670 57/86 (66%)
foxn2NP_001017017.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..52
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 83..108 6/36 (17%)
Forkhead 108..195 CDD:278670 57/86 (66%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 126 1.000 Domainoid score I5338
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005460
OrthoInspector 1 1.000 - - otm48206
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5832
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.