DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHES-1-like and foxd4l1.1

DIOPT Version :9

Sequence 1:NP_001259311.1 Gene:CHES-1-like / 31678 FlyBaseID:FBgn0029504 Length:1268 Species:Drosophila melanogaster
Sequence 2:NP_001016928.1 Gene:foxd4l1.1 / 549682 XenbaseID:XB-GENE-479247 Length:352 Species:Xenopus tropicalis


Alignment Length:157 Identity:52/157 - (33%)
Similarity:77/157 - (49%) Gaps:22/157 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   630 DNEDSLKEF--------DLVVSSRLHTSTPQYSVSKNGANGYGNGNSNVNGSGAGSNTPQKQKHP 686
            |:..|||..        ::..|..|..|....:.|::.::|...|.::.:.....|....|:   
 Frog    32 DDSCSLKSHFYLQPTHSEMGDSGILSPSKLSCTESESDSSGESEGGTSKDSPATPSGGKAKR--- 93

  Fly   687 NNVPYDPLVHTNNKPPYSFSSLIFMAIEGSNEKALPVKEIYAWIVQHFPYFKTAPNGWKNSVRHN 751
                  .||    |||||:.:||.|||..|..|.|.:..|..:|...|||:|.....|:||:|||
 Frog    94 ------ALV----KPPYSYIALITMAILQSPHKKLTLSGICDFISSKFPYYKDKFPAWQNSIRHN 148

  Fly   752 LSLNKSFVKVEKAP-NMGKGSLWRVEP 777
            ||||..|:|:.:.| |.|||:.|.::|
 Frog   149 LSLNDCFIKIPREPGNPGKGNYWTLDP 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHES-1-likeNP_001259311.1 Forkhead 700..785 CDD:278670 38/79 (48%)
foxd4l1.1NP_001016928.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32 52/157 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 47..92 7/44 (16%)
Forkhead 97..183 CDD:278670 38/79 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.