DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHES-1-like and foxj1

DIOPT Version :9

Sequence 1:NP_001259311.1 Gene:CHES-1-like / 31678 FlyBaseID:FBgn0029504 Length:1268 Species:Drosophila melanogaster
Sequence 2:XP_012827170.1 Gene:foxj1 / 496834 XenbaseID:XB-GENE-853648 Length:512 Species:Xenopus tropicalis


Alignment Length:347 Identity:92/347 - (26%)
Similarity:145/347 - (41%) Gaps:79/347 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   624 NSYASYDNEDS-------LKEFDLVVSSRLHTSTPQYSVSKNGANGYGNGNSNVNGSGAG----- 676
            :|::|..|.|.       |:||.::          ..:|.|..::|..:|..:::|:...     
 Frog   102 DSFSSSVNLDDSLTSLQWLQEFSIL----------NANVGKAPSSGDSHGYKHLSGAPCSPLAAD 156

  Fly   677 --------------SNTPQKQKHPNNVPYDPLVHTNN---KPPYSFSSLIFMAIEGSNEKALPVK 724
                          |::..:..|....|.:.:.:..|   |||||:::||.||::.|.:..:.:.
 Frog   157 PACLGMPHTPGKPISSSTSRASHLGLQPMEDIDYKTNPHVKPPYSYATLICMAMQASKKTKITLS 221

  Fly   725 EIYAWIVQHFPYFKTAPNGWKNSVRHNLSLNKSFVKVEKAPN-MGKGSLWRVEPQQRQNLIQALN 788
            .||.||..:|.||:.|...|:||:||||||||.|:||.:..: .|||..|:::||....|:    
 Frog   222 AIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPREKDEPGKGGFWKIDPQYADRLM---- 282

  Fly   789 RSPFFPNSAVDK--ISPSLKSPSGGSAYDSLDGGGSGSVSSAQPVAGGAGVPAAAAVALSTPTKS 851
                  |.|:.|  :.|....|    |:.|.....||:.:...|            ..||..::|
 Frog   283 ------NGAMKKRRLPPVQIHP----AFASAQAAASGNSNRGSP------------WQLSVNSES 325

  Fly   852 NGLAL----ANGASQATNAARPHSPNGGGSG-SHARFDP-----YLFPNLSKAFRNIREDTVGQP 906
            :.|..    |.| .|..||...|..|....| ||.|..|     :..|.||.:....:|:.....
 Frog   326 HQLLKEFEEATG-EQGWNALGEHGWNAISDGKSHKRKQPLPKRMFKAPRLSSSPMLCQEEQTELG 389

  Fly   907 MLQDALDDELSGDYHNNNNNNS 928
            .|:...|.|:..|...|..|.|
 Frog   390 SLKGDFDWEVIFDSSMNGVNFS 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHES-1-likeNP_001259311.1 Forkhead 700..785 CDD:278670 39/85 (46%)
foxj1XP_012827170.1 Forkhead 197..283 CDD:278670 39/95 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.