DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHES-1-like and foxd1

DIOPT Version :9

Sequence 1:NP_001259311.1 Gene:CHES-1-like / 31678 FlyBaseID:FBgn0029504 Length:1268 Species:Drosophila melanogaster
Sequence 2:NP_998078.2 Gene:foxd1 / 405849 ZFINID:ZDB-GENE-040426-2094 Length:343 Species:Danio rerio


Alignment Length:318 Identity:88/318 - (27%)
Similarity:125/318 - (39%) Gaps:82/318 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   620 LRSPNSYASYDNEDSLKEFDLVVSSRLHTSTPQYSVSKNGANGYGNGNSNV------------NG 672
            |.|..|.||..:|::  :.|:|               ..|.:|.|:..|.|            ||
Zfish     3 LSSEMSDASVLSEET--DIDVV---------------GEGDDGDGHTRSYVDEVAQMHDEILLNG 50

  Fly   673 SGAGSNTPQKQKHPNNVPYDPL-VHTNNKPPYSFSSLIFMAIEGSNEKALPVKEIYAWIVQHFPY 736
            |..|.:.     .|...||.|. .:|..|||||:.:||.|||..|.:|.|.:.||..:|...|||
Zfish    51 SPPGVDA-----SPARDPYKPASKNTLVKPPYSYIALITMAILQSPKKRLTLSEICDFISNRFPY 110

  Fly   737 FKTAPNGWKNSVRHNLSLNKSFVKVEKAP-NMGKGSLWRVEPQQRQNLIQA--LNRSPFFPNSAV 798
            ::.....|:||:|||||||..|||:.:.| |.|||:.|.::|:........  |.|...|.... 
Zfish   111 YREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNGSFLRRRKRFKRQQ- 174

  Fly   799 DKISPSLKSPSGG-----SAYDSLDGGGSGSVSSAQPVAGGAGVPAAAAVALST----------- 847
               :|.|....||     :||      |.|      |...|.|:...:..|.|.           
Zfish   175 ---APELLREHGGFLPSAAAY------GYG------PYGCGYGLQLQSYHAHSALLAFQQQQQQQ 224

  Fly   848 --PTKSNGLALANGASQATNAARPHSPNGGGSGSHARFDPYLFPNLSKAFRNIREDTV 903
              |:::.|..:...:...|......|          ||.|.|.|.:|.:.:...:..|
Zfish   225 PPPSRNTGTLIPAPSLMPTTTELTRS----------RFYPPLSPGISSSLQTAAKSPV 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHES-1-likeNP_001259311.1 Forkhead 700..785 CDD:278670 39/85 (46%)
foxd1NP_998078.2 Forkhead 74..160 CDD:278670 39/85 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.