DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHES-1-like and croc

DIOPT Version :9

Sequence 1:NP_001259311.1 Gene:CHES-1-like / 31678 FlyBaseID:FBgn0029504 Length:1268 Species:Drosophila melanogaster
Sequence 2:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster


Alignment Length:622 Identity:137/622 - (22%)
Similarity:211/622 - (33%) Gaps:256/622 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   614 GGGGANLRSPNSYASYDNEDSLKEFDLVVSSRLHTSTPQYSVSKNGANGYGNGNSNVNGSGAGSN 678
            |.|.|:..:..|.||             .::..|.:..|||.....|:.||.|            
  Fly    21 GYGSASAVAAASSAS-------------AAAAAHYAYDQYSRYPYSASAYGLG------------ 60

  Fly   679 TPQKQKHPNNVPYDPLVHTNNKPPYSFSSLIFMAIEGSNEKALPVKEIYAWIVQHFPYFKTAPNG 743
            .|.:.|.        :|    |||||:.:||.|||:.:.:|.:.:..||.:|::.|||::....|
  Fly    61 APHQNKE--------IV----KPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYRDNKQG 113

  Fly   744 WKNSVRHNLSLNKSFVKV---EKAPNMGKGSLWRVEPQ-----------------QRQNLI---- 784
            |:||:|||||||:.||||   :|.|  ||||.|.::|.                 ::::::    
  Fly   114 WQNSIRHNLSLNECFVKVARDDKKP--GKGSYWTLDPDSYNMFDNGSFLRRRRRFKKKDVMREKE 176

  Fly   785 QALNRSPFFPNSAVDKISPSLKSPSGG-------------------------------------S 812
            :|:.|.... |..:.::.| ||..:.|                                     |
  Fly   177 EAIKRQAMM-NEKLAEMKP-LKLMTNGILEAKHMAAHAAHFKKEPLMDLGCLSGKEVSHAAMLNS 239

  Fly   813 AYDS------LDGGG--------SGSVSSAQPVAGGAGVP------AAAAVALSTPTKSNGLALA 857
            .:||      |.|||        ...::...|....:..|      ..|.||.|.....:..|.|
  Fly   240 CHDSLAQMNHLAGGGVEHPGFTVDSLMNVYNPRIHHSAYPYHLNEDNLATVASSQMHHVHHAAAA 304

  Fly   858 NGASQ----ATNAARPHSPNGGGSGSHAR------------------FDPYLFPNLSKAFRNIRE 900
            :.|.|    ..:.|.|.:|.|.|:|..:.                  :.|              |
  Fly   305 HHAQQLQRHVAHVAHPLTPGGQGAGGQSSGHSPTTISTPHGPAHGGWYTP--------------E 355

  Fly   901 DTVGQPMLQDALDDELSGDYHNNNNNNSGSKYNYMGANGSGGAGSGGVGSNANGASDGINFARLA 965
            ....:|:..:......:...|||||::|...:|.:|..|.||.|.||                  
  Fly   356 TPPSEPVPHNGQQGTPTHPGHNNNNSSSVLNHNGVGNGGGGGGGGGG------------------ 402

  Fly   966 RDCGADSIDDVHAAAAMLYLKHGPKIYSEPFQNGSGPVITSSPS-----EDHTYSAGGNSNADSG 1025
                                             ||..|:||||:     .|..:....:...|:|
  Fly   403 ---------------------------------GSSSVLTSSPTSALGFRDMIFEQNQSCQLDTG 434

  Fly  1026 SST-PLTNGNALASVAQAVAQGQNNQGGAGSDSNCASSDAAYDSSEENHNITPEEMADRQRHRDG 1089
            |.| .|.:.:..||.:.|.|.              |::.||..||..:|:          .|.  
  Fly   435 SPTGSLQSASPPASASVAAAS--------------AAAAAAVISSHHHHH----------HHH-- 473

  Fly  1090 VDALLSLSGSSIVECGSVATTHYHSNGSSGSSHGSPH 1126
                .:||| ::.:.|.:          |..||..||
  Fly   474 ----AALSG-NLGQLGQL----------SNLSHYRPH 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHES-1-likeNP_001259311.1 Forkhead 700..785 CDD:278670 40/108 (37%)
crocNP_524202.1 Forkhead 70..156 CDD:278670 40/87 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.